(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE399

PENCW_10.PE399       Location/Qualifiers
FT   CDS_pept        join(complement(949681..952672),complement(948061..949622))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000214083" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18129526"
FT                   /orf_name="Pc13g03990"
FT                   /product="Pc13g03990 protein"
FT                   /function="zinc ion binding"
FT                   /protein_id="CAP91468.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR011016"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR018957"
FT                   /db_xref="UniParc:UPI0001830911"
FT                   /db_xref="UniProtKB/TrEMBL:B6H255"
FT                   /transl_table=1
FT                   /translation="MEPMDYQFRSNADNTAFPDLMNDPAYDEREKGFDDLDTCRICHGE
FT                   ATEDEPLFYPCKCSGSIKFVHQVCLVEWLSHSQKKHCELCKTPFRFTKLYDPNMPQSLP
FT                   APLFAKQALIQCFRTLVTWLRFVLVAFVWLGWLPWSMRAIWRALFWLADGRWSANDNVR
FT                   NQAAQTAQYGLGQLSSNGSAAVTDSITSTISNAATSSTTAVPSARSSILNFAAGEPLML
FT                   TLIKKVIPTLFMPAFTSTVGQGNGQNNVTTSSTKPRYPSWLSDVKFLNSLTPYPTINNM
FT                   IMDTLEGQLITLLVVVAFILLFLIREWVVQQQPMVNIAEGEREAALRLIANDNDRINDR
FT                   FNQGGPRQPEPIPAHPENEVNDEPAEAHGLNNDVLPHFAPHSPALSSNDSEYGPPGSEA
FT                   ELRDYSGNDPEGPPTARALAFRDLVARTHGNHEEMLRILREEAHGDDLDWIVNAITGAT
FT                   MNRDSSAGPSTRPHDLDNPEDLDGADASNLGNGNVEDHPPNADAGPSAQNVDHGPPTRE
FT                   NAIPVPNVQMDDRPPPGITERLFEWFWGDITPVERDAEEPVPEDEEHIVQNPALEDPFV
FT                   RLPNRMENIQPDAAADAAAAADAGLDPNDIDAIEGDDFEGIMDLIGMHGPIFGLFQNGV
FT                   FCALLIAFTVAIGIWLPYLWGKIALVLLANPLELIIGVPIAAFEVVADIALDTLIGVVG
FT                   YLMYWFSLIFKIVLSPFSALLPMGEWIPRDKSVTSASLSLIDASSHRLNKVIKAFLVFH
FT                   ESDIPMFSVLSHQALKLHQARLGAVFQSVFATLKFILHDFPLRLVTLGVPDALSLDLDF
FT                   SHFKNAIGQAQQQLTTFAKSSIFSMPGTRFLNVSAAKAASATAPVDYDLVVWDSKDRVI
FT                   AIFMGYLLAFMVGLLYLRIAGLLSGANRGQRMEGLLAEVLVQAGGVMKVILIIGIEMIV
FT                   FPLYCGSLLDLALLPLFSDATVASRVAFTAASPLTSLFVHWFVGTCYMFHFALFVSMCR
FT                   KILRSGVLYFIRDPDDPTFHPIRDVLERSITTQLRKIGFSALVYGALVIVCLGGVVWGL
FT                   HFALDGVLPIHWSASAPMLEFPVDLLFYNFVLPVVIQSFKPSDGLHDLYDWWFHKCAHF
FT                   LRLSNFFFPERHLEEEGYHVRKTWWAILSRSEGDWEHPVVGDDQQAAAERENRDVYFMR
FT                   DGRYVRAPGSDQVRIPKGNNVFLEVTENNERVDGKVDFADELHGRSSNMFTKVYIPPSF
FT                   RTRIAAFILLIWLFAATTGVGITIIPLVIGRKIIGSYSSTPAPVNDVYAFSSGLCVVGA
FT                   LAYLAYYSSTALNFVRENSGAYLRSPRQAAQTGLNLVLHAARLLYMAQVAIILLPSLFA
FT                   LLTELYILIPAHTLFGDGESHVVHVVQDWALGVLYVQMAIKLTFWQPHSWVAAAVNSVF
FT                   QDGWLKPNASLATRALVLPIVLFTAAAVTLPLSFGFIVRWTIFYSHIGVQPNIYRYAYP
FT                   TTLLVVLSVWMVHLLLRRVAVWRTNIRDEVYLIGERLHNFSEKRARDVGVSRVMTG"
     atggaaccca tggactacca attccgcagc aatgcggaca acaccgcgtt tcccgatcta        60
     atgaacgatc cggcttatga cgaaagggaa aagggatttg acgacctgga tacctgtcgg       120
     atatgtcatg gcgaggcaac ggaagacgaa ccgctgtttt acccgtgcaa gtgcagcggt       180
     agtatcaaat ttgtccacca agtatgcctt gttgaatggt tgtcacactc acagaagaaa       240
     cactgtgagc tctgcaaaac gccgttccga ttcacgaaac tatacgaccc aaacatgccc       300
     cagagccttc ccgcacctct gtttgcgaag caagccctga ttcaatgctt ccggactttg       360
     gtgacatggt tgagatttgt tctcgttgca ttcgtctggc taggatggct accgtggtcg       420
     atgcgcgcca tctggagagc actgttttgg cttgctgatg gccggtggtc tgccaatgat       480
     aacgttcgga accaagccgc acaaaccgcc caatatggtc ttgggcaact gtcctcaaat       540
     ggcagtgctg cggtaactga ctcgattact tcgacaattt ctaatgctgc cacctcatct       600
     actactgctg taccatctgc acgatcgtca attctcaatt tcgcagctgg cgagccgctc       660
     atgctcacgc taattaaaaa ggtgataccc actctgttca tgcctgcatt tacttcgacc       720
     gttgggcaag gcaacggaca aaacaacgtc acgaccagct caaccaaacc tcggtatccc       780
     tcatggcttt cggatgtgaa gttcctgaac tcgttgacac cgtatccaac aataaacaac       840
     atgatcatgg acacattaga aggacagctt atcacactcc ttgtggtcgt tgcgttcatt       900
     cttctcttcc tcattcgtga gtgggttgtt cagcagcaac ctatggtcaa tatcgcggaa       960
     ggagaacgcg aggctgctct tcggttaatc gcaaatgaca atgatcggat aaatgatcga      1020
     ttcaatcaag gcggtcctag acaaccagaa cccattcccg ctcacccgga aaatgaggtc      1080
     aacgatgaac ccgctgaagc ccatgggttg aacaatgacg tccttcctca ttttgctcct      1140
     cactctccag ctctgtcgtc gaatgattct gagtacggcc cccctgggtc cgaagcggaa      1200
     ctacgagact acagtgggaa cgacccggaa ggccctccta cggctcgtgc tctggctttt      1260
     cgagacctag tggcccggac tcatggaaac catgaagaaa tgctgcgcat tctccgtgaa      1320
     gaggctcacg gggatgatct ggactggatt gtgaatgcca tcactggagc gaccatgaac      1380
     cgggattcat cagcagggcc ttctacacgt ccccacgacc tcgacaatcc agaagactta      1440
     gatggcgctg atgctagtaa tcttggaaat gggaatgtcg aggatcaccc gcctaatgca      1500
     gacgccggac cttctgccca gaacgtggat cacgggccac cgactagaga gaatgccatt      1560
     cctgtcccca acgtacaaat ggatgatcgg cctccaccgg gcatcactga acgactgttc      1620
     gaatggtttt ggggagacat cacacccgtg gagcgtgatg cggaagagcc agttcccgaa      1680
     gatgaagaac atattgttca gaatccggcc ttggaagacc cattcgtgcg cttgccgaat      1740
     cggatggaaa acatccaacc agatgctgcc gctgatgctg ccgcggccgc ggatgctggg      1800
     ctggacccta acgatatcga tgcaatcgaa ggggacgact tcgaagggat catggacctt      1860
     attggcatgc acggtcccat tttcgggctt ttccagaacg gcgtcttctg tgcccttctg      1920
     attgcgttca cagtagccat cgggatctgg ctcccgtacc tatggggtaa aattgctcta      1980
     gtgttgttag ccaaccctct cgaactcatc atcggtgttc ctatcgccgc gtttgaagtc      2040
     gtcgcagaca tcgctcttga tactcttatt ggtgtcgtgg ggtatctcat gtactggttc      2100
     agcctcattt tcaagattgt actgagccct ttcagtgctc ttttgcctat gggagaatgg      2160
     attccccggg acaagtccgt cactagtgca tccctttccc tcatcgacgc aagcagtcac      2220
     cgcttgaata aggtgatcaa agcattcctg gtcttccatg agtctgatat ccccatgttc      2280
     tcagtgctct cgcaccaggc gcttaaatta caccaagctc gactcggtgc tgtgttccaa      2340
     tccgtctttg ccactctcaa gtttatcctg catgacttcc cacttcgact tgtcactctc      2400
     ggtgttcccg atgccctttc cttggacctt gatttttccc atttcaagaa tgctattggt      2460
     caagcccaac agcaactcac caccttcgct aaatcatcga ttttctcgat gcctggaacg      2520
     aggtttctga acgtaagtgc agcaaaggca gcttctgcca cagcgccggt cgattatgat      2580
     ctggtggttt gggattcaaa ggatcgtgtt atcgctatat tcatgggcta tttgcttgcg      2640
     ttcatggtag ggcttctcta tctgcgaatc gcagggctgc tgtctggtgc caatcgggga      2700
     caaaggatgg agggtcttct tgctgaggtc ctggtacaag ccggaggagt tatgaaggtc      2760
     atcctcatca tcggtattga gatgattgtt ttccctttgt attgtggcag tcttcttgat      2820
     cttgctttac tcccactctt ctccgacgct acagtggcct ctcgtgtcgc ttttactgct      2880
     gcatctccgc tcacttcgct tttcgtgcac tggtttgttg gcacttgcta catgttccac      2940
     tttgccctat ttgtttccat gtgcagaaag attttgagaa gcggtgtgct ttacttcatt      3000
     cgtgaccccg atgacccaac tttccaccca atacgtgatg ttctcgaacg cagcatcact      3060
     acccagctcc gtaagatcgg tttcagtgcc cttgtatacg gtgcgctagt gattgtctgt      3120
     ctaggaggtg tcgtctgggg cttgcacttt gctctcgatg gtgtcctccc gattcactgg      3180
     tcggctagtg ccccgatgct cgaattccca gttgatctcc tattctacaa ctttgtgttg      3240
     cctgtagtca tccaatcatt caaaccttca gatgggttgc atgatttata tgactggtgg      3300
     ttccacaagt gtgctcattt cctgcgtctc agcaactttt tcttcccgga aagacacctg      3360
     gaggaagaag gctaccacgt ccggaagacc tggtgggcta ttctctctag aagcgagggt      3420
     gactgggaac acccagtagt tggagatgat cagcaggctg cagctgagcg ggaaaaccgt      3480
     gacgtctact tcatgcgcga tggtcgatac gtgcgcgccc ctggctctga ccaggtccgc      3540
     attcctaaag gcaacaacgt tttcctcgag gtcaccgaga acaatgaacg tgttgatggg      3600
     aaggtcgatt tcgctgatga gttacatggc cgatccagca acatgttcac caaagtctac      3660
     atccctcctt ccttccgcac tcgcattgct gcctttattc ttctaatctg gctttttgcc      3720
     gctaccaccg gggtaggcat cactattatt cccttggtaa ttggtcggaa gatcatcggg      3780
     tcctactcct ctactccggc tccggtgaac gacgtctacg cattttcaag tggtctctgt      3840
     gtggtcggtg cgcttgccta cctggcatac tactccagca ccgcactcaa cttcgtgcgg      3900
     gagaattcag gcgcatacct tcgttccccc cgtcaagcag cccagactgg tctaaacctc      3960
     gtgctacatg ctgctcgact tttgtacatg gctcaagttg ccattatcct tctaccgtca      4020
     cttttcgcgc tgcttactga actatacatt ctcatcccag cgcacaccct ctttggcgat      4080
     ggagagtcgc atgttgttca tgtcgttcag gactgggcgc tcggagtgtt gtatgttcag      4140
     atggccatca agttgacttt ctggcagccc cattcctggg tggcagctgc ggtcaacagt      4200
     gtcttccaag atggttggct gaagccgaat gcgagccttg ccacacgtgc ccttgttctt      4260
     ccaattgttc tcttcactgc agctgctgtc actttgcctt tgtcatttgg gtttattgtg      4320
     cgctggacaa ttttctactc ccacatcgga gtgcagccta atatttatcg ctatgcttat      4380
     cccactacac tcttggtcgt gctgtctgta tggatggtac atctactgtt gagacgagtg      4440
     gcggtctggc gcaccaatat ccgtgacgaa gtctatctca ttggagagag actgcacaat      4500
     ttcagtgaga aacgagcacg ggatgtcggt gtgtcgcggg tgatgacagg gtga            4554
//

If you have problems or comments...

PBIL Back to PBIL home page