(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE4

PENCW_10.PE4         Location/Qualifiers
FT   CDS_pept        12098..13576
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977560"
FT                   /orf_name="Pc13g00040"
FT                   /product="Putative uncharacterized protein Pc13g00040 "
FT                   /protein_id="CAP91073.1"
FT                   /db_xref="UniParc:UPI0001830CF7"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5H1"
FT                   /transl_table=1
FT                   /translation="MAESGSGVSQPKAAAADAQASYIQPDSSKGTGAHITNQSQSIQSQ
FT                   SKPPYNTQEEQPSPDGTRETVPGEPNDQPMGDAGSEREPSGSPVAGPRSGHMAENATES
FT                   GSPASVGANDPSDSSDEVLTDLKKLSIGSDRDGEPDAWSRLGRSNVLLVRYGPYKAAKY
FT                   RVQPGNGYNTQGLQKVSKKKTRISCVMYEGEDGEEHYRYSRDNIVGFVGVAFYERKADP
FT                   DKDYKIAPPAFVKVKWQGIDAAHQGLLTRGNSWITKQDLVRLTDLATAEQKISEAWDKQ
FT                   EERHIQWQGQIGRDSPDRSPTPCPLDLFKAQKQERIKRELTIKRELTREPSIPSAQGME
FT                   VDPEGWRLGSRQPAANNTQRLDSVSVKQELDSEDDEDNDLFVDDSSPNARNASDQNTSD
FT                   QNTSGQNTSGQDGNGPNNNGLNNDIRSGSGQNRPPPKLSKFYKRWLRRARIPETDFNNL
FT                   DDAYIGRFEAAAYAYMDELRKQGYVVEDDLGMDI"
     atggctgaaa gcgggagtgg agtctctcaa cccaaggctg ctgctgcgga tgcgcaagcc        60
     tcgtacatcc agccggattc cagtaaaggt accggcgcgc atataacaaa ccaaagccag       120
     tcgattcagt cacagtcgaa acccccgtac aacactcaag aggagcagcc aagtcctgat       180
     ggtacgcgag aaacggttcc aggtgaaccg aacgaccagc ctatgggcga cgccgggtct       240
     gaaagggaac catctggatc ccctgtggcc ggcccaaggt cgggtcatat ggctgagaac       300
     gcaactgaat ctggtagtcc tgcttctgtc ggcgccaatg acccgtcgga ctcgtcggat       360
     gaggtcctga ctgacctgaa gaagctctca attggcagcg atcgcgatgg agaaccagac       420
     gcctggagtc gtcttggacg gtcaaacgta ctgctggttc ggtacgggcc ctacaaagcg       480
     gcgaaatacc gggtccagcc tggaaatggg tacaacaccc aagggctgca gaaagtatcc       540
     aaaaaaaaga cccgaatttc gtgcgtgatg tacgaagggg aggacgggga agaacattat       600
     agatacagta gggacaacat cgtcggcttt gttggtgtgg cattttatga aagaaaagca       660
     gacccggaca aggactacaa aatagctccc ccggcctttg tcaaagttaa atggcaagga       720
     atcgatgctg cgcatcaggg attattgacc aggggcaact cctggattac caagcaagat       780
     ctggtcagac tcactgacct agccacggca gagcaaaaga tctccgaggc ttgggataag       840
     caggaggaac gtcacattca gtggcaaggc caaataggaa gagacagccc tgatcgttca       900
     cccactcctt gcccgctgga tttattcaaa gcacagaagc aggagaggat aaagcgcgag       960
     cttacaataa agcgcgagct tacaagagag ccttctatac caagtgcaca aggtatggag      1020
     gtggatcccg aagggtggag gctaggaagt cgccaaccag cggcgaacaa cacacagcgg      1080
     cttgattcag tttcggtgaa gcaggaattg gacagtgagg acgatgaaga caatgatctg      1140
     tttgtcgatg actccagtcc taatgcacgg aacgccagtg atcagaatac cagtgatcag      1200
     aataccagtg gtcagaatac cagtggtcag gatggcaacg gtccgaacaa caatggcctc      1260
     aataatgata taaggagcgg atctggtcaa aatcggcctc cacccaaatt aagcaagttc      1320
     tataagagat ggttgagaag agcgagaatt ccggaaactg atttcaataa cctcgacgat      1380
     gcatacattg ggagatttga agctgctgca tacgcttata tggacgagct gaggaagcaa      1440
     ggctacgttg tagaagatga tctgggtatg gatatctag                             1479
//

If you have problems or comments...

PBIL Back to PBIL home page