(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE40

PENCW_10.PE40        Location/Qualifiers
FT   CDS_pept        join(complement(101204..101767),complement(100869..101129),
FT                   complement(100436..100619),complement(100088..100213),
FT                   complement(99639..100003))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948695"
FT                   /orf_name="Pc13g00400"
FT                   /product="Pc13g00400 protein"
FT                   /protein_id="CAP91109.1"
FT                   /db_xref="UniParc:UPI0001830DCC"
FT                   /db_xref="UniProtKB/TrEMBL:B6H168"
FT                   /transl_table=1
FT                   /translation="MPPTGSKWYRWIADTSLPNLYAISAAIILAICLIYWLARDVSLWM
FT                   WTRHHVVFLFPFRSRMLGSWRRLAFVHLPKCLHWLDIPNYREALILAVMLAANIVGLRL
FT                   RAHSWAEAQKRAGSLAVINLVPLCTGISFGLPADLLHVDRQMLAWFHRWIGRICVLHSL
FT                   FHCSLLVAAARTMNLVTPRHIFPIAALVLVIPVTCAAVQRRYLQFAMKCHYLLAATAIG
FT                   TLIYHLVERRSLYRWYLVGAICLWFFISAVVCIMAAWNQKPWGSSQKEVVMNSILGPYG
FT                   HPLDFYRFGTILFVVEDIGFFRALSYIEMLVEASCRREVMVRKLEVLWKRQVGKDGPQN
FT                   NISYEYAERICYFYGSIKIEEEVERYLNNHQCGAVAVAVCAGPSIREAVTKTIRLRTGR
FT                   NLQLMVFDPDMCPAPDGLVDSLSSDETPAGSQDPPHQLLGVGEDRHTHQVRRFLADSSK
FT                   LQYPSPKEIYTEAGNVEMNNHSKWVESRLAQGRRKPTTTKP"
     atgcccccaa ccgggtcaaa gtggtatcga tggattgctg atacatctct ccccaactta        60
     tatgccattt cagccgccat aatcttagca atttgcttga tctattggct tgcacgagat       120
     gtgtccctct ggatgtggac aagacaccat gtggtctttc ttttcccttt ccgatcgaga       180
     atgctaggct cctggaggcg acttgccttc gttcatctgc caaaatgcct gcattggctt       240
     gacatcccaa actaccggga agcgctaatc ctagctgtca tgctcgcggc aaacattgtt       300
     ggtctccggc ttagagccca ttcttgggcc gaagcgcaga aaagggctgg ctctttggca       360
     gtcatcaacc tcgtgccttt gtgcaccggt atcagctttg gacttccggc ggacctgctc       420
     cacgtggacc gccagatgct ggcgtggttt caccgctgga taggtcgcat ctgtgtgctc       480
     cattctttgt ttcactgttc gctgcttgtt gctgccgcca gaacgatgaa cctggtgacc       540
     ccacggcaca tttttccaat tgccgctctc gttctcgtga taccggttac ttgtgcggcg       600
     gttcaacggc gatacttgca gtttgcgatg aaatgtcact accttcttgc agcaacggcg       660
     attggcacgc ttatatacca tctcgtggag cggcggtcac tgtatcggtg gtacctggta       720
     ggcgccatct gcctgtggtt tttcatcagc gctgttgtct gcataatggc cgcatggaat       780
     cagaaacctt ggggatcttc ccagaaggag gtagtcatga actcgatact cggtccctac       840
     ggacaccctc tcgatttcta ccggttcggt acaatcctct tcgtcgtgga ggatattgga       900
     ttttttcgag cgctttcata cattgagatg ttggtggagg caagctgtag gcgcgaagtg       960
     atggtgcgaa agctcgaggt tctatggaag cgccaagttg gcaaagatgg accccagaac      1020
     aatatttcct acgaatatgc cgaaaggatt tgctactttt atggctcgat caaaatcgag      1080
     gaagaagttg aacggtatct caataaccac caatgcggag ctgtggccgt agcggtatgt      1140
     gcgggtccgt caatacgtga ggctgtgaca aagactatac ggctacgcac aggaagaaat      1200
     ctccagctaa tggttttcga ccccgatatg tgtcctgcgc cggatggact tgtagattca      1260
     ctcagcagcg atgagactcc agctggcagc caggatccac cacatcaact tttgggagta      1320
     ggcgaggata ggcatactca ccaagtacga cgattcctag cggacagcag caagctacag      1380
     tacccatcgc ctaaagaaat ctatacggaa gctggaaacg tcgaaatgaa caaccactcg      1440
     aagtgggtgg aaagtagatt ggcacaaggg cgcagaaagc ctacaaccac taaaccttga      1500
//

If you have problems or comments...

PBIL Back to PBIL home page