(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE400

PENCW_10.PE400       Location/Qualifiers
FT   CDS_pept        join(953521..953639,953703..954440,954498..955914)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000214072" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19825160"
FT                   /orf_name="Pc13g04000"
FT                   /product="Pc13g04000 protein"
FT                   /protein_id="CAP91469.1"
FT                   /db_xref="UniParc:UPI0001830912"
FT                   /db_xref="UniProtKB/TrEMBL:B6H256"
FT                   /transl_table=1
FT                   /translation="MVVKENGQVADATPKPNGQTRLEKPRKKGFVRWTVGLVVRLCIWY
FT                   TLVTTFLRCPSRLTDLTETSPRVCKPYLIARSHVEPYVTPYYDIYAAPYVDQARPYVDQ
FT                   ARPYVEVFNQQVYTPASKVAKSGYEKYGAPALKQAQVYGIEQWQRQVAPRLQTAQDKAH
FT                   KLYLTEIDPYVQQSVAVVSPYYQLVNTAVLNVYQGHLVPLYARSKPFIGIAYSTGQDVL
FT                   TTHVLPWAQYSWSSAVYFANSSLWPHITGLYSEQVEPQLVKIGQRLASYREGKRLRAVV
FT                   EDVDSSTVQPVTSSATKSQEQIHTTTTVTSTSTPQASPQPTLTPTEQAQQAREKIDSDL
FT                   ERWQEKFALAADKGIEDLEDRIEEIVSALVASSANSHGRSLHTALQSVSAEQLSSIKQR
FT                   INELAASMPEEDAPEIEEATSDLLIGEIRTSAISVRDRAHALREWSISFEDELVRRVNA
FT                   AVNSTLDVLDSIRDLGLQEIGMRWAWMDGVTYKDWAKYHALKAQLEEWRNDIRNVGMNH
FT                   KSVSDARAVASEILDQGMHEAEQAARELVRLKDVGIWKIAAREVSDDFETRTEAPPARP
FT                   KPQEQTKESDEEEAKVDSDDDESSEEVAASMSDDAYEETLSTNEPSAAADAEADFDGAN
FT                   ESVMDDDIVEEEQPPARPAFGVSAADANSHQAPILDGEGQDVMDSPASKSGDTYAVASN
FT                   AVSEAIYGASSTPGVGERAASLASDQYSLAWSAASTVINGTPLSSGEKAYSDASEKYSD
FT                   AVAA"
     atggtagtga aagagaatgg tcaagtggca gatgccacgc ccaaaccaaa tggtcaaacg        60
     cgtcttgaaa agccacggaa gaagggcttt gtgcgatgga cagtcggact tgtcgtgagg       120
     ctatgtatct ggtacacact cgtgacaacg ttcctcagat gcccatcccg cctcacggac       180
     ctcacagaga cgtcgcctcg agtgtgcaag ccttacctga ttgctcgttc acacgtggaa       240
     ccttatgtga cgccatatta tgatatttat gcagcccctt atgttgatca agcccgacct       300
     tatgttgatc aagcccggcc atacgtggaa gtgtttaatc agcaagtcta taccccggca       360
     tcaaaagttg ccaaatcagg atatgaaaag tatggagcgc cagcgttgaa gcaagctcag       420
     gtttatggga ttgagcaatg gcaacgtcaa gtcgcaccaa ggctacaaac cgctcaagat       480
     aaggcgcaca agctttactt gaccgagatt gacccatacg tccagcaaag cgttgctgtt       540
     gtttctccat actatcaatt ggtcaacact gctgtgctca atgtctatca gggccatctg       600
     gtacctttgt acgcgcgttc caaacctttc atcgggatag cctactccac gggccaggat       660
     gttttgacaa cccatgtctt gccctgggcg cagtatagct ggtcgtccgc ggtctacttt       720
     gctaacagct cactatggcc tcacatcact ggtctttatt ctgagcaagt ggagccccag       780
     ctggtcaaga ttggccagcg gttggcaagt tacagggagg gcaagcgact tcgcgctgtc       840
     gtagaggatg tggatagctc tacagtccag cccgttacct cctcggccac caagtcacag       900
     gaacaaattc acaccacaac cactgtgact tcaacctcta cgccccaggc ttctccacaa       960
     cccactctaa ctcctaccga gcaagcccag caagctcgcg agaagataga ttcggacctt      1020
     gagcggtggc aggaaaagtt tgctctcgca gctgataaag gtattgaaga ccttgaggac      1080
     cgtattgagg agatcgtgtc cgccctagtt gcaagcagcg cgaacagtca cggccggagc      1140
     cttcataccg cacttcaatc agtttcagcc gagcagcttt cctcgatcaa gcaacgtatc      1200
     aatgaactcg cggcttcaat gccagaggag gacgccccgg agattgagga ggctactagc      1260
     gacttgctga ttggggaaat ccgaacttct gctatttctg tgagagatcg cgcccatgca      1320
     ctccgagagt ggtctatctc gttcgaggat gaacttgttc gccgagtcaa tgctgctgtc      1380
     aattcgacac tggatgttct cgacagcatt cgcgatctag gcttacaaga aattggcatg      1440
     cgctgggcgt ggatggatgg cgtcacatac aaggactggg caaagtacca tgccctcaaa      1500
     gcccaactcg aagaatggcg caacgatatc agaaatgtcg gcatgaacca caaatccgta      1560
     tccgatgcca gagccgtggc gagtgaaatc ttggaccagg gcatgcatga agctgagcaa      1620
     gctgccaggg aacttgtccg gttgaaggat gttgggatct ggaagatcgc tgctcgcgaa      1680
     gtaagcgatg atttcgaaac tcgcactgaa gccccgccgg cgaggcccaa gccccaggag      1740
     cagaccaaag aatctgacga agaagaggct aaggtggatt ctgatgacga cgaatcgtcc      1800
     gaagaggtgg ctgcgtccat gtcggacgac gcttatgagg aaaccctttc caccaatgag      1860
     ccttccgcag ctgccgatgc tgaagcagat ttcgatggcg ctaacgagtc tgttatggac      1920
     gatgatattg tggaggaaga gcagcccccc gcaaggcccg cctttggggt ttcagctgcc      1980
     gatgcaaatt cgcatcaagc gcctatccta gatggtgagg gccaggatgt catggacagt      2040
     ccggcgagca agtcgggcga tacttatgcc gtggcgagca atgctgttag cgaagctatc      2100
     tatggtgcat cgagcacgcc cggagtcggt gagagggcag catcattggc cagtgaccag      2160
     tactctcttg cctggtccgc cgcctctacc gttataaatg gcactcctct gagttccgga      2220
     gagaaggctt acagtgatgc ctctgagaaa tatagcgacg ccgtagccgc gtaa            2274
//

If you have problems or comments...

PBIL Back to PBIL home page