(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE401

PENCW_10.PE401       Location/Qualifiers
FT   CDS_pept        956123..957532
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19825161"
FT                   /orf_name="Pc13g04010"
FT                   /product="Pc13g04010 protein"
FT                   /protein_id="CAP91470.1"
FT                   /db_xref="UniParc:UPI0001830913"
FT                   /db_xref="UniProtKB/TrEMBL:B6H257"
FT                   /transl_table=1
FT                   /translation="MAESSAPAHSQLLSSIESAYSGSVKYATDELESKLRAVRATPTPS
FT                   NAGPLAQISSIASSRLNQGLSLASEQLSQVQPPATTGSLPHGHLDPFVLDAQRRYYEAV
FT                   GLAHDHYSAFVSTASGVVYGSPIPTPTGGSKGIIEEARSQYEQASSLASASLAAVVASA
FT                   SSAMSSADGGKPQSIIEDASSRYNAALSAASSSLSTASISASSAIYGTSTGPVESISSQ
FT                   ASENWESLISKASEQIYGAPTPYLQQVVNNGRAQYEAVQEIVSELIVGKQPSYTESVLS
FT                   KLRAAYETPYPAAAASASSYINEAYGSASSAAASVVSEAPSVEDIIQGANDQLHAAVET
FT                   ASVGIYGTPKGSYQKATDAAADAYSTASAQVSYAVYGKESSYIDVAKDAIENIQSTASA
FT                   AIYGEEPNAMESAAVRLAEAKENAMSQLADLASRLPGSNAASEAVETAASHVKDTTSSI
FT                   KSVAASVKDEL"
     atggctgaat ctagtgctcc tgcccattcc cagctcctat cttccataga gtcggcctat        60
     tctgggtctg taaaatatgc cacagatgag ctggaatcaa agctccgcgc tgttcgtgcc       120
     accccgacgc catccaacgc cggacctctg gcccagattt cgtccatcgc gtcttcccgg       180
     ctaaaccagg ggctcagctt agcatccgaa caattatctc aagtacagcc accggcaaca       240
     acaggcagtc ttccccatgg acatctcgat ccgttcgtcc ttgatgcgca gcgtcgctac       300
     tacgaggcag tcgggttggc ccacgaccac tattctgctt ttgtctctac ggcatctggg       360
     gtggtctatg gttctccaat tcccacgcca accggaggct ccaagggaat cattgaggaa       420
     gctcggtctc aatacgaaca agcttcgtcg ttagcttctg ccagtcttgc tgctgtcgtc       480
     gcttcggcga gctcggccat gtcttccgcg gatggcggca aaccacaaag tattattgaa       540
     gatgcttcat cccgatacaa cgctgccctc tccgcggctt cctcgtctct ctccacagct       600
     tccatttcgg cgagctcggc catctatggg acttccacgg gccctgtaga gtccatttct       660
     agtcaagcat ctgaaaactg ggaaagtctc atttctaaag ccagcgagca gatctacggt       720
     gcgccaacgc cgtatctgca acaagttgtg aacaacgggc gtgcgcagta tgaggcagtc       780
     caagagattg tctctgaatt gattgtgggc aagcagcctt catatacgga gagtgtgctg       840
     agcaagctgc gagccgcata cgagacgccg tacccggccg ccgccgcctc tgcctctagc       900
     tacatcaatg aagcctatgg gtctgcgtcc tccgccgctg cttctgtcgt ttcagaagcc       960
     ccgagcgtgg aggacatcat acaaggcgcg aatgaccaac tccatgctgc tgttgaaact      1020
     gccagcgttg gcatatacgg aactcccaaa ggttcctacc aaaaagccac tgatgccgca      1080
     gccgatgcct actcaacggc ttccgctcag gtcagttacg ccgtttacgg caaggaatcc      1140
     agttacatcg atgtggcgaa ggatgctatt gagaatattc aatccacagc cagcgcggct      1200
     atctacggcg aggaacccaa cgcaatggag agtgcagctg tccgtctcgc tgaagccaaa      1260
     gaaaacgcca tgtctcagct ggctgatcta gcctcccgcc tcccaggtag caacgccgcg      1320
     tctgaggcag tcgagaccgc cgcatcccac gttaaagata caacaagcag cattaagagt      1380
     gtggcagctt cagtcaaaga tgaactttga                                       1410
//

If you have problems or comments...

PBIL Back to PBIL home page