(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE402

PENCW_10.PE402       Location/Qualifiers
FT   CDS_pept        join(complement(958866..958874),complement(958269..958775))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000214061" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20672469"
FT                   /orf_name="Pc13g04020"
FT                   /product="Pc13g04020 protein"
FT                   /protein_id="CAP91471.1"
FT                   /db_xref="InterPro:IPR008506"
FT                   /db_xref="UniParc:UPI0001830914"
FT                   /db_xref="UniProtKB/TrEMBL:B6H258"
FT                   /transl_table=1
FT                   /translation="MAQKAAKSLATRNGAVLSRTHLISAALHLLFLLLHFVFQRPRSLK
FT                   PYLFLAVPTLAIEYYLDRMGRPRYNEDGSLRSAGEDLNATGLTEYMWDVLYWTQGCIVA
FT                   VCLFNDRAWWLWVVIPLYSVYAAYTTIMGVKKGFAGMGGGDAGQEGDVPKSKTQLKKEK
FT                   RGPTMKYR"
     atggctcaga aagcagccaa atctctagcg acccgcaatg gtgccgtcct cagccgtact        60
     cacctcatct ctgctgcatt gcatctgctc ttcctcctgc tgcactttgt cttccagcgg       120
     ccacgttcac tgaagccata cctctttctg gcagttccaa cgcttgccat tgaatactat       180
     ttggaccgca tgggccggcc ccgctacaac gaagatggtt cccttcgctc cgccggcgag       240
     gaccttaacg caactggcct gacggagtat atgtgggatg tgctttactg gacccaggga       300
     tgcatcgtcg ctgtctgcct cttcaatgac cgggcctggt ggttgtgggt tgtgatccca       360
     ttgtactctg tgtacgctgc ctataccacg ataatgggtg tgaagaaggg atttgctggc       420
     atgggtggtg gtgatgccgg ccaagagggt gatgtcccaa agagcaagac gcagctgaag       480
     aaagaaaaga gaggtcccac tatgaagtat aggtga                                 516
//

If you have problems or comments...

PBIL Back to PBIL home page