(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE403

PENCW_10.PE403       Location/Qualifiers
FT   CDS_pept        join(959636..959972,960030..960203,960255..962098,
FT                   962177..962248)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000214050" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15950891"
FT                   /orf_name="Pc13g04030"
FT                   /product="Pc13g04030 protein"
FT                   /function="binding"
FT                   /protein_id="CAP91472.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR013105"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniParc:UPI0001830915"
FT                   /db_xref="UniProtKB/TrEMBL:B6H265"
FT                   /transl_table=1
FT                   /translation="MALSTGHVASQLRHLIYYQLDNNLIRNALFLASRLHAYEPRSFEA
FT                   QFLLALCHLHNGEVKAAFECSQASGSRGLHAGCAYVFAQACLDLGKYLDGVTALERSKS
FT                   LWASKNHWNKHSETQRQHLPDAAAVYSLQGKLWHAHKDLTKAVDCYVEALKLNPFMWDA
FT                   FLGLCETGVNIRVPNIFQLSPELLAIISSSPEEIATAPDNVAYEEGTFPVQPPGNPESD
FT                   PFMVSASRGESDATFGSSALWEKLNGSSANFAAIAQPVFHDGMETPGAQSSGSDDFRIA
FT                   NGVTDPEAGWEAPLAPARKTRTIQTMSLDHTGQPPPRMRPTGIRPRHKTRTEPETQPTA
FT                   PVERDPSLVSRFGDRKRTVSGQVAHPLPSSQPTEPGAPQRRSVRLFNQIKPTTSKLSNG
FT                   TLTGRDGREMKKLRGGPTKGRAGSAPTVGRVVSGNRKPVETPDNDGKDNRTGLSQSHST
FT                   APPLPKNAEKTKELEALDWLLGLFNKLASGYFALSRYKCADAISSFNSLSQGQRETPWV
FT                   LSQLGRTYFEQASYTEAAKYFSRVQKLAPSRIEDMEIYSTVLWHLKSDVELAYLAHQLL
FT                   EADRLSPQAWCAIGNSFSHQRDHDQALKCFKRATMLDPGFAYAFTLQGHEYVANEEYDK
FT                   ALEAYRHGINADNRHYNAWYGLGTVYDKMGKLDFAEQHFRNAASINPTNAVLICCIGLV
FT                   LEKMNNPQDALVHYGRASSLAPHSVLAKFRKARVLMKLREYKFALAELKVLKDMAPDEA
FT                   NVHYLLGKLYKMLHDKANAIKHFTAALNLDPKAAQYIKDAMESLDDDDMEDEDIA"
     atggccttgt ccaccgggca tgttgccagc cagctacggc acctcatcta ttaccaactc        60
     gacaataact taattcgcaa tgcgcttttc ctcgcttccc gcctccacgc ctatgaaccg       120
     cgatcctttg aggcccaatt tctgctcgcc ctttgccatc tacacaacgg agaagtgaag       180
     gcagcatttg aatgcagcca ggcttcgggc tcgcgtggtc tgcatgctgg ctgtgcttat       240
     gtctttgctc aggcttgctt ggacttggga aaatacttgg atggtgttac tgctctggag       300
     cgcagtaaat ctctctgggc ctccaagaac cactggaaca agcatagtga aactcagcga       360
     cagcacctgc ctgatgctgc tgccgtttac tctctgcagg ggaagctttg gcacgcacac       420
     aaagatttga ccaaagcagt tgactgctat gtggaggctc tcaaattgaa ccccttcatg       480
     tgggacgcat tcctggggct ttgcgaaaca ggtgtcaata ttcgagtccc aaatatcttc       540
     cagctcagcc cagaacttct tgcaataata tcttcgtcgc cggaggaaat agctactgcg       600
     ccagacaatg tggcttatga agaagggacc ttccctgtgc agcctcctgg taaccctgaa       660
     tctgaccctt ttatggtctc tgcctcgcgt ggcgagtctg acgccacatt tgggagctct       720
     gctctctggg agaagctaaa tgggagctcc gccaattttg ctgctatcgc acagccggtg       780
     ttccacgacg gaatggaaac cccaggtgca cagagcagtg gctctgatga cttccgcatt       840
     gcgaatggcg tcactgaccc agaagctgga tgggaagcac ccttggcccc agcccgaaag       900
     acgcggacaa tccaaactat gagccttgac cataccgggc aacctcctcc gcgaatgcgt       960
     ccaacaggca tcagacctcg acacaaaaca cgaaccgaac cagagaccca gccgactgct      1020
     cccgtagaaa gggatccctc tcttgtatca agatttggcg accgaaaacg cacagtctct      1080
     ggtcaagtcg cacatcccct tccttcgtca caaccaacgg aaccaggtgc tccacagcgc      1140
     cgaagtgttc gacttttcaa ccagatcaaa cctacaacca gcaagctttc caacggcacg      1200
     cttactggca gagatggccg cgagatgaag aagttaagag gtgggcctac gaaaggacgg      1260
     gcaggaagtg cgcccactgt cggccgtgtc gtgagtggca atcgaaaacc ggtggagaca      1320
     cccgacaatg acggtaaaga taatcggact ggcttgtcgc aatcccactc tactgctccc      1380
     ccattaccca aaaatgctga aaaaaccaaa gagctcgaag ccttggattg gcttttgggt      1440
     cttttcaata aacttgcatc tggatatttc gcattgagcc gttacaagtg tgccgacgcc      1500
     atcagctctt tcaattctct ctcccaaggg cagcgtgaaa ccccttgggt tttgtctcaa      1560
     cttggacgga cctatttcga acaagcaagc tacacggaag ctgccaagta cttttccagg      1620
     gtccaaaaat tagcgccctc ccgcattgag gatatggaaa tctattcgac tgttttatgg      1680
     catctgaaaa gtgatgtaga actggcttac ttggcccatc agctacttga agctgatcgc      1740
     ctgtcccctc aggcgtggtg tgctattggc aactctttct ctcatcaacg ggatcacgat      1800
     caagcactca agtgcttcaa gcgtgcgacc atgctcgatc ctggatttgc atatgctttc      1860
     acgctacagg gacatgaata tgtcgctaac gaagaatatg acaaggcgtt ggaggcctat      1920
     cgccacggaa tcaacgctga taatcgacat tacaatgctt ggtatgggct ggggacggtg      1980
     tacgataaga tgggcaagct cgacttcgct gagcagcatt tccgcaatgc agccagcatc      2040
     aacccgacga atgcggtgct catttgctgc attggtctgg ttttggaaaa aatgaacaat      2100
     ccccaagatg cgctggttca ctacggtcga gcctcctcgc tagcccccca ctcggtatta      2160
     gccaagttcc gcaaggcgcg cgtgctcatg aagctgcgcg aatacaagtt tgctttggcg      2220
     gaattgaagg tcctgaagga catggcgcca gatgaagcaa atgtgcatta ccttcttggg      2280
     aagctttaca aaatgctcca cgacaaggcc aatgctatca agcatttcac ggcggccttg      2340
     aacttggatc caaaggcagc acaatacatc aaggacgcaa tggagtcgtt ggacgacgac      2400
     gatatggagg atgaggacat agcgtag                                          2427
//

If you have problems or comments...

PBIL Back to PBIL home page