(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE405

PENCW_10.PE405       Location/Qualifiers
FT   CDS_pept        join(complement(965816..965905),complement(964559..965737))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000214028" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18129527"
FT                   /orf_name="Pc13g04050"
FT                   /product="Pc13g04050 protein"
FT                   /function="holo-[acyl-carrier-protein] synthase activity "
FT                   /function="magnesium ion binding"
FT                   /biological_process="macromolecule biosynthetic process "
FT                   /protein_id="CAP91474.1"
FT                   /db_xref="GO:0000287"
FT                   /db_xref="GO:0008897"
FT                   /db_xref="GO:0009059"
FT                   /db_xref="InterPro:IPR008278"
FT                   /db_xref="UniParc:UPI0001830917"
FT                   /db_xref="UniProtKB/TrEMBL:B6H267"
FT                   /transl_table=1
FT                   /translation="MASIQVWMLRIQGANIRDHNAMVDPSVSGINDIPKDQPTLVRWYM
FT                   DVRRWDEKYFDLPLLETLTQPDQAAVKKYYQTSDKRLSLASQLLKYYYIHQATGTPWSK
FT                   IEIQRTPMPENRPFYDSSLDFNVSHQAGLTLFAGTRAATAHSLSGGPQTLPRVGIDVAC
FT                   VDEPSRRRANRPPKTLADLATFVDVFSDVLSLRELATIKNPYATLKLARELGLNKSDPS
FT                   KDDQEVLAAYGIRLFYSIWALKEAYLKMTGDGLLASWIKDLEFTNVVPPEPVQTVGFAG
FT                   DPSATHAPSVQNWGRPYSDVKISLRGIPDHSVRVQLVGFESDYIVATAASGPNIGSVSR
FT                   QVVVNDSDHHLPGRITAFDSETGLQNVRIPPIALRSIGDGDPWRVDSKISDPWLPMQEV
FT                   DIEIDIRPCADGRCEHLRDLPSF"
     atggcttcta tccaggtgtg gatgctccgc atccaaggtg cgaatatacg agatcacaat        60
     gcaatggtag accccagtgt gtctggaatt aatgacatcc ccaaggacca gcccacgttg       120
     gtccgatggt acatggatgt cagacgttgg gatgaaaaat actttgatct ccctttgctt       180
     gaaaccttaa cacagcctga tcaggcagct gtcaagaagt actatcaaac atcggacaag       240
     cgcctgtcct tggcctccca gttgctgaaa tattactaca ttcaccaagc cactggcact       300
     ccctggagca agattgagat ccagcgtact ccgatgcccg aaaatcgacc attctacgat       360
     tcaagcctgg atttcaacgt cagccatcag gctggtctca ctctgttcgc aggcacgcgt       420
     gccgcaacag cccactcctt atccggtgga cctcaaacat tgcctcgcgt gggaattgac       480
     gttgcgtgtg ttgatgaacc ctctcgtcgt cgtgctaatc gtcccccgaa gacacttgcc       540
     gaccttgcaa ccttcgtgga tgtcttcagt gacgttctct cactccgtga gcttgcgacc       600
     atcaagaacc cgtacgcgac tcttaaattg gctcgtgagc ttggtctgaa taaaagtgac       660
     ccgagcaaag acgaccagga agtccttgct gcctacggca ttcggctgtt ctactcgatt       720
     tgggctctca aggaggctta cttgaaaatg accggagacg gccttctggc ctcttggata       780
     aaggatctgg aattcacaaa cgttgttccc cccgaaccag ttcaaacagt cggatttgct       840
     ggtgatcctt ctgccactca cgcgccctcg gtccaaaatt ggggccggcc ttactccgat       900
     gtcaaaatct ccttgcgtgg cattcctgac cattctgtgc gcgttcagct cgtcggcttc       960
     gagtccgact acatagttgc cacggccgcg tcgggcccca atattggatc cgtttcgcgg      1020
     caggtagtcg tgaatgacag cgatcaccat ctgccagggc gtatcacagc cttcgactct      1080
     gagactggac tccagaacgt ccgcattccc ccaatcgcgc ttcgatcaat tggcgatggg      1140
     gacccctggc gtgtggactc gaaaatcagc gacccctggc tccccatgca ggaggtcgat      1200
     attgaaatcg atatccggcc ctgtgcggat ggtcgttgcg agcacctacg ggatttacca      1260
     agcttttaa                                                              1269
//

If you have problems or comments...

PBIL Back to PBIL home page