(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE406

PENCW_10.PE406       Location/Qualifiers
FT   CDS_pept        join(966426..966658,966713..967283)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000039949" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15950893"
FT                   /orf_name="Pc13g04060"
FT                   /product="Pc13g04060 protein"
FT                   /function="transferase activity"
FT                   /biological_process="glutamine catabolic process "
FT                   /biological_process="pyridoxal phosphate biosynthetic
FT                   process"
FT                   /protein_id="CAP91475.1"
FT                   /db_xref="GO:0006543"
FT                   /db_xref="GO:0016740"
FT                   /db_xref="GO:0042823"
FT                   /db_xref="InterPro:IPR002161"
FT                   /db_xref="InterPro:IPR021196"
FT                   /db_xref="UniParc:UPI0001830918"
FT                   /db_xref="UniProtKB/TrEMBL:B6H268"
FT                   /transl_table=1
FT                   /translation="MAITVGVLALQGAFFEHVQLLKKAAEQAQPSEWHFIEVRTPQELA
FT                   TCDGLVLPGGESTTMSLVAARSNLLEPLREFVKVDRKPTWGTCAGLILLAESANKTKKG
FT                   GQELIGGLDVRVNRNHFGRQTESFQGPLDLPFLGQDAPPFPAVFIRAPIVEKILPHHEG
FT                   IQAEEIQQEDVVVAPSREARDSVAQAATAEHVEVLATLVGPAAQHATEGRDVNPDQEVG
FT                   DIVAVRQGNVFGTSFHPELTGDARIHAWWLREVQAAVLRREKLKQ"
     atggctatca ctgttggagt cctggcccta cagggcgcat tctttgagca tgtgcagctt        60
     ttgaaaaagg ccgctgagca agcgcagccg tcggaatggc acttcattga agtacggacg       120
     ccacaagaac tggcaacatg cgacggcctg gtcttgcccg gaggcgagag taccactatg       180
     tctttagtcg cagcaaggtc aaatcttctc gagccactgc gagaattcgt aaaagtggat       240
     cgcaaaccga cgtggggtac atgcgccggg ctcattttgc ttgccgagtc tgccaacaag       300
     acaaagaagg gcgggcaaga gctgatcggt ggtcttgatg tgcgagtgaa ccgaaaccac       360
     ttcggtcgac agaccgaaag cttccaaggc ccgttggatc tgcctttctt gggtcaggac       420
     gcgcctccct tcccggcagt attcattcgc gcccctattg tggaaaagat tcttccccac       480
     catgagggca ttcaagcaga agagattcaa caggaagatg ttgtcgtggc accgtccagg       540
     gaagcacgag actcagtggc gcaggcagcc acagcagagc atgttgaggt actagcaaca       600
     ttagtgggac cggcagctca acacgcgacg gagggtcgag acgtcaatcc agaccaggag       660
     gttggcgaca ttgttgcagt gcgacaggga aatgtattcg gcaccagctt ccacccggag       720
     ctgacaggtg acgcaagaat ccacgcttgg tggttgcgcg aagttcaagc agcagtgctg       780
     agacgagaga agttaaagca ataa                                              804
//

If you have problems or comments...

PBIL Back to PBIL home page