(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE407

PENCW_10.PE407       Location/Qualifiers
FT   CDS_pept        join(complement(968162..968227),complement(967968..968071),
FT                   complement(967866..967910),complement(967622..967813),
FT                   complement(967435..967564))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000217589" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19825162"
FT                   /orf_name="Pc13g04070"
FT                   /product="Pc13g04070 protein"
FT                   /function="nucleic acid binding"
FT                   /function="nucleotide binding"
FT                   /protein_id="CAP91476.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniParc:UPI0001830919"
FT                   /db_xref="UniProtKB/TrEMBL:B6H259"
FT                   /transl_table=1
FT                   /translation="MSLLARNTVDRLDRPSAYYVSKNKRRRFNDRDEDEPQQEEKPDEK
FT                   LKNATTLYVGNLSFYTTEEQIHELFAKCGEIKRLVMGLDRFNKTPCGFCFVEYYTHQDA
FT                   LDCLKYIGGTKLDERIIRTDLDPGFEEGRQFGRGKSGGQVRDEYREEYDPGRGGYGRAY
FT                   DEQRQREEDEYGAGR"
     atgagtttac tggctagaaa tacagtcgac cgactggatc ggccgagtgc ctactatgtc        60
     agcaagaaca agcgacgcag attcaacgat cgcgacgaag acgaaccgca gcaagaggag       120
     aaacctgatg aaaaattgaa gaacgcgaca accctctacg tgggaaatct ttccttttat       180
     accaccgagg aacaaatcca tgaactcttc gccaagtgcg gcgagatcaa gcgacttgta       240
     atgggcctcg accgattcaa caaaacaccc tgcggctttt gcttcgtcga gtattatacc       300
     caccaggatg cgctggattg cttgaaatat atcggaggaa ccaagttgga cgagcggatc       360
     attcggacag accttgaccc tggatttgag gaaggacggc agttcggacg aggcaaatcg       420
     ggtggtcaag tgcgtgatga ataccgtgaa gaatatgatc cgggccgtgg tggatatggc       480
     cgcgcctatg atgagcagcg ccagcgcgag gaggatgaat acggcgccgg aaggtag          537
//

If you have problems or comments...

PBIL Back to PBIL home page