(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE408

PENCW_10.PE408       Location/Qualifiers
FT   CDS_pept        join(968476..968784,968856..970967,971024..971187,
FT                   971242..971299)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000214017" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18129528"
FT                   /orf_name="Pc13g04080"
FT                   /product="Pc13g04080 protein"
FT                   /protein_id="CAP91477.1"
FT                   /db_xref="UniParc:UPI000183091A"
FT                   /db_xref="UniProtKB/TrEMBL:B6H260"
FT                   /transl_table=1
FT                   /translation="MVKVNSYAPAWLCRPSPGAKFLSSSSAQNPAEDLQTGRKPVSSGA
FT                   TRTIAKRGNEVFAVVDNEIRWSNLARLKDQWQQEIKQKKGSVSETEEQTDNTQISPYRV
FT                   LAVPVYGLIKQIIPSPNGAFLAIVTEHTVHISVLPDSSHLSSSDSDSIRLKTYQLGPTT
FT                   HVIPEAPVVSALWHPLGLHTNLGGCIVTITADAAVRVWELDRNNHWSFDQPTLAIDLKK
FT                   LVDGTSSDQDFTPSGFGKSKGFSADVIDMEVASACFAGSGNEKEDAWAPMTLWVAMRPG
FT                   DLYALCPLLPSKWQAPSTTIPSLSAAIIPKLGALEQEPEESEEELIACRQQYDWLSELD
FT                   EQEPLDTPSGSETIQGADVFTRPANPSAIPRLQGPFRFDSGDELDDLDLCDLLVIAASL
FT                   NVEDLMMGEEEELAVETGDQEKLSATVLSLTSGNGRVHVCLELDGVEGQWLPKAKKNAF
FT                   RTPISEPTELVLVESLDTIKDGEETTTWPTFTKDVHSRYSFFVTTATNVVFLSLSGWVQ
FT                   RLEAELQTEDTAGSAFRLRVLCDGDVTNRQRILQVSDADTTAQNEHLAASLVFHDFDLG
FT                   YLLLTYHPSNPYAVVMDAPEDSLSVALDKSLYEPRAPAPGLPVLPPSRAPYQVPAIFYA
FT                   NSPLDSFVEKHVPHRQRHTLKEQVRLSPATLDLVATAHRVLSAHTNALERAASDLFRRC
FT                   ERLQGEMQDQLKQLADVAERVKGVTSEIGEDGHRKEGVRNGEALDKRLQAAQDKQSELN
FT                   RRYEALRTKVLNSGGRPLSEREKAWITEVKTLSASLQQVEEQEEEQPLVSRLETVKRLA
FT                   RDLMAQTKSVAGKMPSPELGTPSSPGGQPKVPQRLQRAKVADAMRMVERESAVIEAITS
FT                   RLERLNTSL"
     atggtgaagg tcaacagtta tgcgccagcc tggctgtgcc ggccctcgcc tggcgcaaag        60
     ttcctgtcca gcagttcagc tcaaaatcca gcggaggacc tgcaaactgg acgcaagccc       120
     gtgagcagtg gagccacgcg aacgatcgct aagaggggaa atgaagtgtt cgctgttgtt       180
     gacaacgaga tacggtggtc aaaccttgcc cgactcaaag accaatggca gcaagagatt       240
     aagcagaaga agggatctgt tagtgaaact gaagagcaaa ccgacaacac tcagatttcc       300
     ccctacaggg ttttagcggt gcctgtgtac ggactgatca agcaaatcat cccctctccg       360
     aacggcgcct tccttgccat cgtcactgaa cacactgttc acatctccgt tttgcccgat       420
     tcttcgcacc tttcgtcctc cgactccgac tctatccggc tgaagacata tcagttagga       480
     ccgacgaccc atgttattcc tgaggctccg gtggtctccg cgctatggca tccactgggt       540
     ttgcacacca atctaggtgg gtgcatcgtt acaatcacag ctgatgccgc ggtgcgtgtg       600
     tgggagttgg atcggaataa ccactggtcc ttcgaccagc cgaccctggc aatcgatctg       660
     aagaagctcg tcgatgggac ctcatctgac caagacttta cgccttctgg atttggcaaa       720
     agcaagggat tctctgctga tgtcattgac atggaggttg catcggcctg tttcgctggt       780
     agtgggaacg agaaagaaga tgcatgggca ccaatgaccc tatgggtggc catgagaccc       840
     ggtgatctct atgcgctttg ccctctcttg ccttctaagt ggcaagcccc ttctacaacc       900
     attccatctc tttctgcggc gattattccg aaactcggtg ctctggaaca ggaacctgag       960
     gagtcagagg aggaactgat cgcctgccgg caacagtacg actggctttc cgagctagat      1020
     gaacaagagc cgctggatac accttctggg tcagaaacaa tccaaggcgc ggatgtgttc      1080
     actcgccccg ccaatcctag cgccattcca agattacaag ggccgttccg cttcgacagc      1140
     ggtgatgaac ttgatgattt ggatctttgt gatcttcttg ttattgctgc cagtctaaac      1200
     gtcgaggatc tcatgatggg tgaggaagaa gaattagctg tggaaaccgg agaccaagag      1260
     aagctttcag caacagttct ctctcttact agtgggaatg gccgagttca cgtctgtctg      1320
     gagctcgacg gtgttgaagg acaatggcta cccaaagcta aaaagaacgc gttccgaact      1380
     cctatttcag aaccgactga attggtcttg gtcgaatcac tagatacaat caaggatgga      1440
     gaggaaacaa ctacatggcc tactttcact aaagacgtcc attctcggta ctcgttcttt      1500
     gtcacaactg ccaccaacgt ggttttccta tctctatccg gttgggtaca gagactggag      1560
     gctgaattgc aaaccgaaga caccgcaggt tccgccttcc gtctccgggt tctctgtgac      1620
     ggggatgtga ccaaccgaca gagaatcttg caggtttcag atgccgatac taccgcgcaa      1680
     aatgaacatc ttgccgcgtc tctcgttttc catgacttcg accttggcta cttgctcctc      1740
     acctaccatc catccaaccc gtatgcagtt gtaatggatg cgccagaaga ttctctatcc      1800
     gtggcgctgg ataaatcgct gtacgagccc agggcgccag cgccaggctt gcctgttttg      1860
     cccccgagcc gggccccata ccaagttcct gccatcttct atgccaactc tccgttggac      1920
     tctttcgtcg agaagcacgt cccgcaccgg caacgccaca cgctcaagga gcaagtgcgc      1980
     ttgtctcccg cgacattgga cctcgtggct actgcacatc gcgtgctatc tgctcataca      2040
     aatgctcttg agcgagctgc ttcggattta ttccgccgct gtgagcggct gcagggcgag      2100
     atgcaggacc aattgaagca gcttgcagat gttgcagagc gtgtcaaggg tgtcacaagt      2160
     gagattgggg aagatgggca tcgcaaggag ggagtccgaa atggagaggc actggataag      2220
     agattgcaag ccgcccagga taagcaaagt gaactgaacc gacgatatga ggcactacgc      2280
     actaaagttc tgaattctgg cggtcgtcct ctgagtgaac gggagaaggc ttggataacc      2340
     gaggtgaaga cactgtctgc atccttgcag caggttgaag aacaagagga ggagcaacca      2400
     ttggtctcac ggttggagac tgtcaaacgc cttgctcggg atcttatggc ccaaaccaag      2460
     tctgtcgcgg gcaagatgcc ttctccggaa cttggaactc cgtcctctcc tgggggccag      2520
     cctaaggtgc cccaacgact gcaacgggcc aaggttgcag atgcgatgag gatggtcgaa      2580
     cgagagtctg ccgttattga ggcaattacc tcacgtttgg aacgactgaa cactagtctg      2640
     tga                                                                    2643
//

If you have problems or comments...

PBIL Back to PBIL home page