(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE409

PENCW_10.PE409       Location/Qualifiers
FT   CDS_pept        join(complement(971696..972393),complement(971500..971557))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15950894"
FT                   /orf_name="Pc13g04090"
FT                   /product="Putative uncharacterized protein Pc13g04090 "
FT                   /protein_id="CAP91478.1"
FT                   /db_xref="UniParc:UPI000183091B"
FT                   /db_xref="UniProtKB/TrEMBL:B6H261"
FT                   /transl_table=1
FT                   /translation="MCIYWTCKYTLCGCIWDMDPSKCQDKRLCWGPRMITLESHTATCA
FT                   DCWARGDKRVYEPPTCEKTDRDEEDPEMATLDFEPNAAESDNISDDDEEYFSAEESLSP
FT                   SPCSRPATPQLYYEVHPPWCPVSEDNDFDLTRACDPVDLTSVGRDYRARRHKTTTLEYL
FT                   SDSEDSFVSCEEYVDEETPDEESFSSGNEEEDLYYSIIGPPGRPKGLIKSLEDRSLLFY
FT                   GSAQEYYPTGEWEQDEAPKWCGFMKRAAI"
     atgtgtatct actggacatg caagtataca ctgtgcggct gtatatggga catggaccca        60
     tcaaaatgcc aagacaagcg gctctgctgg ggtccaagaa tgataactct cgaatcccac       120
     acagccacat gcgcagactg ctgggcgaga ggggacaagc gggtttacga accaccaacg       180
     tgtgaaaaaa ctgacagaga cgaggaagac cccgaaatgg cgacgttgga tttcgaaccc       240
     aacgcagctg agagtgataa tatttccgac gatgacgagg agtatttctc agctgaagag       300
     tccctgtcgc catccccatg ctcgcgacct gcaaccccgc aactatacta tgaggtacat       360
     ccgccgtggt gtcctgtatc cgaggacaac gactttgatt tgaccagggc ctgtgatccc       420
     gtggatctta cgtcagtggg gagggactat cgagcacggc gccacaagac gaccacattg       480
     gagtacttgt cggatagtga ggattctttt gtttcttgtg aagagtatgt cgatgaagaa       540
     acccccgacg aggagagttt cagctctggg aatgaagaag aagatcttta ctatagtatt       600
     attggtcccc ctggtaggcc caaaggcctg atcaaaagct tggaggatcg atcgttgctg       660
     ttctatggct cagctcagga gtactatcca acaggagaat gggaacagga tgaagccccg       720
     aagtggtgtg gattcatgaa aagagcagct atttga                                 756
//

If you have problems or comments...

PBIL Back to PBIL home page