(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE41

PENCW_10.PE41        Location/Qualifiers
FT   CDS_pept        join(complement(103532..104103),complement(103238..103373),
FT                   complement(103100..103160),complement(102944..103065),
FT                   complement(102673..102769),complement(102107..102396))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948696"
FT                   /orf_name="Pc13g00410"
FT                   /product="Putative uncharacterized protein Pc13g00410 "
FT                   /protein_id="CAP91110.1"
FT                   /db_xref="UniParc:UPI0001830E8F"
FT                   /db_xref="UniProtKB/TrEMBL:B6H169"
FT                   /transl_table=1
FT                   /translation="MSQCQKGISLLFRHEGYYEIACSIMEQLTASDVGALLASLRITPA
FT                   QHTVETFLQPLRDFDPTMRQFESWFQDKCQILIIGPDTIRLSDRIFNADEYYKGKRPSQ
FT                   TQLEVWIFAIPANFEKGAKEVQCLRHCSHASSLFSIQERAEALIAGQELLENNLIRQIS
FT                   YTDAEPSKVPGEYLDVKVFDLFSTTTHRRERPSASSKTPKPGILPRVPGLGSTVNGFYP
FT                   YQLVLNSCGALSQQRKYLGLDDADPTAVDVEPETSHQVASWRPLQFHAPPSHRSQSYRS
FT                   LMVQALIHAFRTNYSAHSSSNNSICFILSLTGPRSKCRDPGSQCLDIQNKRHPTQRFEF
FT                   IIMSLQAEVSRMQHEYILMLQNGDNMLRAYANENAKLEEQNRSLLEHVKLLQQENCSLE
FT                   LDHNRLESELAKERLQCPEQADGKRL"
     atgtctcagt gccagaaagg aatttcgttg ttatttcgtc acgaaggcta ctacgagata        60
     gcatgcagca taatggaaca gctgacggct tcggatgttg gcgctctctt agcttcactt       120
     cggattacgc cagcccagca tacagtagag acgttcctac agccactacg agactttgac       180
     cccaccatgc gacagtttga gtcttggttc caggacaaat gccagatact gatcatcggc       240
     ccggacacca ttcgattgag cgaccgaatc ttcaatgcag acgagtacta caaagggaag       300
     cgcccaagtc aaacccagct ggaggtgtgg atttttgcga tacccgccaa ttttgagaag       360
     ggtgctaagg aagtccaatg cctcaggcac tgttctcatg cctcctcttt attctctata       420
     caggagcgcg cagaagcact gattgctgga caagagcttc tcgaaaataa tctgatcagg       480
     cagatcagtt atacagatgc cgaaccaagc aaagtacctg gagagtacct agatgtcaaa       540
     gttttcgatc tttttagcac gaccacacat cgccgtgaaa gaccgtcggc gtcatcaaaa       600
     accccaaagc ctggtatttt accccgtgta cccggattgg gatccacagt caacggtttc       660
     tatccctatc agctcgtcct gaactcttgc ggagctttgt cgcaacagcg gaagtaccta       720
     ggactcgatg acgccgaccc aacagcagta gacgtggagc cagagacaag ccatcaggtt       780
     gccagctggc gtcccctaca attccacgcc ccgcctagcc acagatctca gagctacaga       840
     tccctgatgg ttcaagccct gatacacgcc tttagaacga attacagcgc tcattcatcc       900
     tccaataata gtatatgctt cattctgtcc ctgactggcc ctaggagcaa gtgtcgcgat       960
     cccgggagcc agtgccttga catccaaaac aaacgacatc caactcaaag atttgagttc      1020
     atcattatga gtttacaggc tgaagtgtcg agaatgcagc atgaatacat tctcatgctg      1080
     cagaacggcg acaacatgct gcgggcttac gcaaatgaaa atgctaaatt ggaagagcaa      1140
     aatcggtctt tgcttgaaca tgtcaaacta cttcagcaag aaaattgctc cctagagctc      1200
     gaccacaaca gactggagtc tgaattggcg aaggagagac tacagtgccc agagcaggcc      1260
     gatggaaagc gactctag                                                    1278
//

If you have problems or comments...

PBIL Back to PBIL home page