(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE410

PENCW_10.PE410       Location/Qualifiers
FT   CDS_pept        join(complement(975283..975285),complement(974833..975233),
FT                   complement(974659..974779))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000275331" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15950895"
FT                   /orf_name="Pc13g04100"
FT                   /product="Pc13g04100 protein"
FT                   /function="isomerase activity"
FT                   /protein_id="CAP91479.1"
FT                   /db_xref="GO:0016853"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="InterPro:IPR001202"
FT                   /db_xref="UniParc:UPI000183091C"
FT                   /db_xref="UniProtKB/TrEMBL:B6H262"
FT                   /transl_table=1
FT                   /translation="MADTGLPAGWEVRHSNSKNLPYYFNPSTKESRWEPPAETDTDKLK
FT                   VYMAQNHTPAARPDPSGEGEGKIRCSHLLVKHRDSRRPSSWREADITRTKEEAIEILKG
FT                   HEQRIQSGETTLGDLAVAESDCSSARKKGDLGFFGRGEMQKEFEDAAFGLQPGQVSSVI
FT                   ETASGVHLIER"
     atggccgaca caggtcttcc cgccggctgg gaagttcgcc attccaactc taagaatctc        60
     ccatactatt tcaacccttc tacgaaagag tctcgctggg agccacctgc ggaaactgat       120
     accgataagt tgaaagtata catggcgcaa aaccacaccc cggctgctcg ccctgatccc       180
     tccggggagg gcgagggcaa gatccgctgc agtcacttgc tcgtcaagca tcgcgatagt       240
     cgccgtccca gcagctggag ggaggccgat attactcgta caaaggagga ggcgattgag       300
     attcttaagg gtcatgaaca gcgcattcaa tctggagaga ccacccttgg cgacctggca       360
     gtcgctgagt ccgactgcag cagtgcccgg aagaagggcg atttgggctt ctttggccgc       420
     ggcgaaatgc agaaggagtt tgaagatgcc gcttttggtt tacagcctgg ccaagtcagc       480
     agcgttattg agacagcatc cggagttcac ctcattgaac ggtag                       525
//

If you have problems or comments...

PBIL Back to PBIL home page