(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE413

PENCW_10.PE413       Location/Qualifiers
FT   CDS_pept        join(978491..978604,978665..979665,979765..980584)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000214006" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20672470"
FT                   /orf_name="Pc13g04130"
FT                   /product="Pc13g04130 protein"
FT                   /protein_id="CAP91482.1"
FT                   /db_xref="InterPro:IPR001214"
FT                   /db_xref="UniParc:UPI00018309F3"
FT                   /db_xref="UniProtKB/TrEMBL:B6H269"
FT                   /transl_table=1
FT                   /translation="MPPKRARKSSPAAERRERLTLAKLASYDDVATDALVDHAYFWTTT
FT                   RKNRTKYSPARGIHDDDVGRILLEDVIVDKDIPKAERKLLELPGLKKYMTNLRSPREKE
FT                   WFRRHLRKYIQMYLPDCPFEVTTTNRYIITQHEAAICARRFIKKGEEIKHLSGTLVSMT
FT                   HEEELDLGLTRKDFSIVMSSRRRAPSFFLGPARFANHDCDANGSLTTRGNEGMSVLAMR
FT                   DIHEGEEITVSYGEDYFGIDNCECLCHTCEIAVRNGWSSHVDTETNSKESSPASEVTAT
FT                   EDTPAENSNVSRKRRRSSDMEEPDSSSTLSCSTPRKRAKFQRQVSKLREEISVSELTGE
FT                   SGSAPPRGSDSTPIQDTVLISNALLAETAPQVVARRGDLNGTNGTNSTIPTDCESLSST
FT                   ADQSHRSSTSTTPTTEDDIEPQIKTEDTTLQPSESKALNGKDHPDASPEGQHITTHPMD
FT                   IDPEEGLSDLSNSTKLDDDKVVDKPKKRKPRTKRRFIVDSVETESQVARFPGDYTKTPR
FT                   LLAQKYDRWVECQTCDTWFLQSNSYLTRRECPRCERHSKLYGFQWPSTDKGPDGEERVM
FT                   DHRTIHRFLSPDAQSRICRRDRGVSFGITPTPELSDTNTPETETSDVTESRRDARATRR
FT                   RTRELRMTM"
     atgcccccaa agagagcgcg aaagagctcg cccgccgcgg aacgtcgcga gcgcttgacc        60
     ctggctaaac tggccagcta tgacgacgtc gcaaccgatg cgctagtgga tcacgcttat       120
     ttttggacca ctacccgcaa gaaccgcacc aagtacagcc ctgcccgcgg aatccacgat       180
     gatgatgttg ggcgcattct tctggaagat gttattgtgg acaaagatat tccaaaggcc       240
     gaacgcaagc tgcttgagtt accaggatta aagaaataca tgacaaacct ccggagccct       300
     cgagagaaag agtggttccg ccgacacctc cgcaagtaca ttcagatgta tcttccagac       360
     tgtccgtttg aggtcaccac gaccaatcga tacatcatca cgcaacatga agctgcgata       420
     tgtgctcgca ggtttataaa aaagggcgag gagatcaaac acctgagtgg aacgcttgtg       480
     tctatgaccc acgaggaaga gttggatctc ggcttgaccc gcaaagactt cagcatcgtg       540
     atgtcaagtc gtcgcagagc cccatcgttc ttcctgggtc ctgctcgatt tgccaatcat       600
     gactgcgatg ccaatggcag cttgacaact aggggcaatg agggcatgtc tgtcctagcc       660
     atgcgcgaca ttcacgaggg agaagagatc accgtttcct acggagagga ttacttcggt       720
     attgacaact gcgagtgttt atgtcatact tgcgagattg ctgtacggaa tggctggtcg       780
     tcgcatgttg acacagagac gaacagcaaa gagtccagtc ccgcgtctga agtcacagca       840
     actgaagata caccggctga aaatagcaat gtgagcagga aacgtagacg cagctcggac       900
     atggaggaac ccgacagctc ctctaccttg tcttgttcta ctcctcgcaa acgtgcaaag       960
     ttccaacgac aagtttctaa gttgcgagaa gagatctcag tttctgaact tactggggaa      1020
     tcaggatcag ctccaccgcg cggatcggac agcactccta tacaggacac tgtactgatc      1080
     tccaatgctc ttctggcgga aactgcaccc caggtagtgg ctcgccgagg cgatctaaat      1140
     gggacaaatg gcactaattc tactattccc acggactgcg aatctctaag ttccaccgcc      1200
     gatcaatccc accggtcgtc gacgtcaact acccctacaa ctgaggatga cattgaaccc      1260
     cagatcaaga cggaagacac tacgctacaa ccgtctgagt cgaaagcact caacggtaag      1320
     gatcatcccg atgcctctcc tgaaggtcaa cacatcacca cccaccccat ggacattgac      1380
     cccgaagaag gattgtcaga cttatcaaat tccaccaaat tagacgacga taaggttgtg      1440
     gataagccca aaaagcgaaa gcctcgtacc aagcggcgct tcattgtaga ctccgtcgag      1500
     accgagtcac aggttgcccg attccctgga gactatacca agacaccacg attgcttgct      1560
     cagaagtatg accgctgggt ggagtgtcag acctgtgata catggttcct ccagtcaaac      1620
     tcgtacctca cgcggcgtga atgtccacgc tgtgaacgcc attccaagct gtacggattc      1680
     cagtggccat caacggacaa aggcccggac ggcgaagagc gagtaatgga tcaccgcacc      1740
     atccatcggt ttttgtcccc cgatgcacaa tcacgtatct gccgccgaga ccgcggcgtt      1800
     agttttggga tcacccccac ccccgagctc tctgacacaa acaccccaga aacggagacc      1860
     agtgatgtaa ctgagtctcg ccgggatgct cgggcaactc ggcgtcgcac tagagaactt      1920
     cgtatgacta tgtaa                                                       1935
//

If you have problems or comments...

PBIL Back to PBIL home page