(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE414

PENCW_10.PE414       Location/Qualifiers
FT   CDS_pept        join(981244..982599,982682..982893,982962..983022)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000217588" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15950896"
FT                   /orf_name="Pc13g04140"
FT                   /product="Pc13g04140 protein"
FT                   /function="hydrolase activity"
FT                   /protein_id="CAP91483.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="InterPro:IPR002018"
FT                   /db_xref="InterPro:IPR019826"
FT                   /db_xref="UniParc:UPI00018309F4"
FT                   /db_xref="UniProtKB/TrEMBL:B6H270"
FT                   /transl_table=1
FT                   /translation="MRFSNLIATLLLGFGVTGSTAWDNPLVSLDYGSFQGQYDSTYNLS
FT                   YFRKIPFAAPPTGENRFRAPQPPLEVTEDVYDTNQDFDMCPQRTVNGTEDCLYLGLFSR
FT                   PWDLAKDTSRPVLVVFYGGAFVQGSAAFAMPPSSFPVLNVSNINDYIVIYSNYRVNAFG
FT                   FLPGKAIKDSHTSDLNPGLLDQQYVLKWVQKHIHRFGGNPHNVTIWGQSAGAGSVVAQV
FT                   LANGRHGQPKLFSKALASSPFWPKTYKYNAPEAEEIYSQLANLTGCASRHADKTLACLK
FT                   SVDVQKIRDASLIIGASNTWTTSSYTWAPVIDGTFLVETLTDTVNRRSLNTEFVWGMYN
FT                   SHEGENFVPSGLDSPVLENGFDSSLASFHQWLSGFVPGLSGKQIDEVETLYPAEGSTET
FT                   IDSYKSSYVRAGLVYRDVVLACPAYWIASAATERGHLGEYTISPAKHASDTIYWNKINA
FT                   VQETNPVVYKGYAGAFASFFQTGDPNAHKVTNASQPGVPELRTGEEFVVVEDRLENVKL
FT                   VQLKKRYFDSIGLGRRYTRKLVRYI"
     atgaggttct caaatcttat tgccaccctt ctcctcggct tcggggtcac tggcagcact        60
     gcatgggaca accctctagt ttccctcgac tacgggtcct tccaaggtca atatgacagt       120
     acctacaacc tctcatattt tcgcaagatc ccatttgctg caccaccaac aggggagaac       180
     cgctttcgtg cacctcagcc accactggag gtcacggaag acgtctatga cacaaaccag       240
     gacttcgaca tgtgccccca gcgcacggtc aacggcactg aagactgtct ctacctgggt       300
     ctattctcac ggccgtggga cctagccaag gatactagca gaccagtgct agtcgtattc       360
     tacggcggag cgttcgtcca aggcagcgcg gcattcgcca tgccgccatc gtcattcccg       420
     gtcctcaatg tcagcaatat taacgactac atcgttatct actccaacta ccgcgtcaat       480
     gccttcggct tcctaccagg caaggcaatc aaagactcac acacctcaga tctaaacccg       540
     gggctattgg accagcaata tgtcttgaaa tgggtccaga aacacatcca ccgtttcggc       600
     ggcaaccctc acaacgtaac aatatgggga cagtcagccg gtgcaggttc agtagtcgcg       660
     caagtcctcg caaatggccg ccatggccaa ccgaaacttt tctccaaagc acttgccagc       720
     tcgcccttct ggccaaagac gtataaatac aacgcaccgg aagcagaaga aatctactcc       780
     cagctggcga acctaacggg ctgtgccagc cgacacgccg ataagacact cgcctgtctc       840
     aaatccgtgg atgtccagaa aatccgcgat gcaagcctga tcattggagc aagcaacacc       900
     tggacaacta gctcttacac ctgggcgcct gtgatagacg gaaccttcct cgtcgagaca       960
     ctcacagaca ctgtgaacag gcgctcccta aacacagagt ttgtgtgggg aatgtacaat      1020
     agccacgagg gtgaaaactt cgttccgtcg ggccttgaca gccccgtgtt ggaaaatgga      1080
     tttgattcct cgcttgcgag cttccaccag tggctttccg gtttcgtgcc tgggttatcg      1140
     ggcaaacaga ttgatgaggt cgaaactctt tatcccgctg aggggagcac agagacgatc      1200
     gacagctata aatcttccta tgtccgggct ggcttggttt atcgggatgt tgtgcttgct      1260
     tgtccggctt attggattgc gtcggccgcg acggagagag gacacctcgg agagtatacg      1320
     atttccccgg cgaagcatgc gagtgatact atttattgga acaaaatcaa cgccgttcaa      1380
     gagactaacc ctgtcgtcta taaaggctat gcaggagctt ttgcgagttt cttccagaca      1440
     ggagatccga atgcacacaa ggtgacgaat gcttcgcagc caggtgtgcc agaactccgt      1500
     acgggtgagg aattcgtggt tgtggaggat aggctcgaga atgtgaagct ggtccagttg      1560
     aagaagagat atttcgattc aattggactc ggacgtcgtt atacaagaaa attagttcgt      1620
     tatatatga                                                              1629
//

If you have problems or comments...

PBIL Back to PBIL home page