(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE415

PENCW_10.PE415       Location/Qualifiers
FT   CDS_pept        complement(983205..985109)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000048380" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18978330"
FT                   /orf_name="Pc13g04150"
FT                   /product="Pc13g04150 protein"
FT                   /function="ATP binding"
FT                   /function="ATP-dependent helicase activity"
FT                   /function="nucleic acid binding"
FT                   /protein_id="CAP91484.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0008026"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="UniParc:UPI00018309F5"
FT                   /db_xref="UniProtKB/TrEMBL:B6H248"
FT                   /transl_table=1
FT                   /translation="MPLPIRSSICFLCQTKATLIAPSILPTSWQTTRGMATVRLRRKAA
FT                   RMALSPTVSKPSLPSPNKPRRERPGPFASMNQTQARIRDTPRTRSQAALKRSGEEGKTE
FT                   KKESPLYKALKMQTTLTPVPYGRRSAIKARLADITSFDHFPLLPAVRQSIFAQALAGLT
FT                   DVTPTPIQRLAIPELLLDESKKKKKVKKANEDEEEYDFDQYLLAAETGSGKTLAYLLPI
FT                   VDAVKRAEVIDMQEEKALEEQKAREREERMKNKAFDLEPEEPPMTNAARPRAIILVPTS
FT                   ELVSQVGSQLKELAHTVKYRSGEISSTFTPRRIKNTLFHPAGIDILVSTPHLLGSVART
FT                   NPNILSRVTHLVLDEADSLMDRSFIPTTSEIIAKVAPSLKKLILCSATIPRSLDNQLRK
FT                   RFPDMQRLTTPNLHAIPRRVQLGVVDIEKEPYRGNRNLACADVIWSIGKAGDRHEHTET
FT                   WGPLNAYMEPKVKKIIVFVNEREEADEVARFLQSKGIDAVSLSRDTDSRKQQETLSQFT
FT                   EVKLPPTAEEIMINKKKNRAAGSIPFEFPERQEPIRRLPDTKVLVTTDIASRGIDTLAV
FT                   KTVVLYHVPHTTIDFIHRLGRLGRMGKRGRGVVLVGKKDRKDVVREVREGMFRGQALI"
     atgcctctac caattcgctc ttcgatatgt tttctatgcc aaaccaaggc gaccctgatc        60
     gccccatcga ttcttccgac gtcatggcag accacacgag gcatggccac cgttcgattg       120
     cgccgcaagg ctgctcgaat ggcgctgtcg cctactgttt ccaagccatc tcttccatct       180
     cctaacaagc cacgacggga acggcccggt ccctttgcct cgatgaacca gactcaggca       240
     cggattcgag acacaccacg cacaagatca caggcggccc tcaagcgttc aggggaggag       300
     ggcaagacgg agaagaagga aagcccattg tacaaagcgt tgaagatgca aacaactttg       360
     acacctgtgc cttatggtcg acgttcggct atcaaagctc gacttgccga cattaccagc       420
     ttcgaccact tccctctcct tcccgcagtt cgacagtcaa tcttcgctca ggctttggct       480
     ggtctcactg atgttacccc cacgcccatt caaagactcg cgatccccga actcttgctg       540
     gatgaatcca agaagaagaa gaaagtgaag aaggcgaacg aagatgaaga agaatacgat       600
     tttgaccagt accttctggc agccgagacg ggctcgggaa agaccctcgc gtacttgctt       660
     ccaatcgtcg atgctgtcaa gcgtgccgaa gtcattgata tgcaggagga gaaagctctt       720
     gaagaacaaa aggcaagaga gcgagaggag agaatgaaga acaaggcatt cgatctggag       780
     cctgaggagc cgccaatgac aaacgccgct cgtcctcggg ccatcattct cgttcctact       840
     tccgaattag tatcccaggt tggatcccag ctcaaggagt tggcccacac cgtcaagtac       900
     cgctcgggcg aaatatcatc aactttcact ccccgccgga tcaagaacac cctcttccac       960
     cccgccggca tcgatatcct agtttcaact cctcaccttt tgggctctgt tgcgaggacg      1020
     aaccccaata tcctcagccg agtcactcat cttgtacttg atgaggccga ttccctaatg      1080
     gaccgatcat tcatcccaac aacgtccgaa atcattgcca aggttgctcc gtcactcaag      1140
     aaattgatcc tctgctccgc caccatcccc cgcagtctcg acaaccagct gcgcaagcgc      1200
     ttccctgata tgcagcgcct aacgactccg aacctgcacg ccattccccg tcgcgtgcag      1260
     ctaggcgtcg tggacattga aaaggagccg taccgcggaa acagaaacct tgcctgtgct      1320
     gatgtcatct ggtcaatcgg caaggccgga gatagacacg agcacaccga gacatggggg      1380
     ccgctcaatg cgtacatgga gccgaaggtc aagaagatca tcgtgttcgt caacgaacgc      1440
     gaggaagccg acgaggtcgc gcgtttcctg caatccaagg gcatcgatgc tgtctcgcta      1500
     tcccgtgaca ccgattcccg caagcaacaa gagaccctct cgcagttcac agaggttaag      1560
     ctcccaccga ctgcggagga gatcatgatt aataagaaga aaaaccgtgc cgccggcagc      1620
     attccctttg aattccctga gcgccaagag cctattcgcc gccttcccga caccaaggtt      1680
     cttgtcacta cagatatcgc ctcccgtggt attgataccc tggcagtgaa gacagtggtt      1740
     ctttatcacg tgccgcacac taccatcgac ttcatccaca gactgggtcg tctcggtcgt      1800
     atgggcaagc gtggtcgtgg tgttgtcttg gtgggcaaga aggaccgtaa ggacgtcgtc      1860
     cgtgaggttc gcgagggcat gttccgtggc caggctctga tctag                      1905
//

If you have problems or comments...

PBIL Back to PBIL home page