(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE416

PENCW_10.PE416       Location/Qualifiers
FT   CDS_pept        join(986834..986923,986975..989744,989799..990496,
FT                   990551..991174)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000213995" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15950897"
FT                   /orf_name="Pc13g04160"
FT                   /product="Pc13g04160 protein"
FT                   /protein_id="CAP91485.1"
FT                   /db_xref="InterPro:IPR001849"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR012966"
FT                   /db_xref="UniParc:UPI00018309F6"
FT                   /db_xref="UniProtKB/TrEMBL:B6H249"
FT                   /transl_table=1
FT                   /translation="MGNGSGQRPLSEVSPMAQRRNSPSWNQVTKMPHGESPAYDVSSLN
FT                   NNNSPRLFWKGRDSPSPFPKGAENKAPYDPEGCYFPTKRPSLENLKRVSKVKNHSMFLE
FT                   GGQEYDPASVVFPHRPLASERSPQRDSQMNVAKSQFDEDTTQISRPSSPSKDQASPSKS
FT                   SLSKGSRYGKGFDPQNDIWSEYGSAGHRHAKSVTFDHAPPQVNEYEMTTPDLSSVASES
FT                   RENSYESDEEGDLSFEAESSIERDDSFDASLEDIEKTPVVLPEDWRFMSPSTNSDGDPF
FT                   VEDVEEDSTEGRPISREGGSSQHTRVESLDSNGERRPLPPLPSVNRTSGARPSSAGKLA
FT                   AAFELGSAGQRVLPSPPAAASYTKSDIPGAGSIEERLRLMMLQERDDDYEKYDDHAKNI
FT                   EEPLELPRADESLTSKDDTHKDDEAKENFFSPPRISRDSILRGIRKGDSYEDDSFDDSS
FT                   QIASSPNRYDHYDPDVPIPSMETDDDDSSSVIIKQEENDEDLYSITDYYQNRSDNSLSS
FT                   RDQRAKYDEDSNYSLRSAAEAAERKHAGYDGHKEGSGETTPNAESQADAQKSAPLNEDA
FT                   KACKEPNAPQDQSFDMASIRQSLARPLTPEMPQDQASEPSTPDSVIRHPIEDDHEEDDN
FT                   KEEEGEVEEEEEPELAHDESSSDESVPEPVATIRAPGAGLKTRPSLTPADMQSMAATRR
FT                   QISGQHAPPVPSLTKQISNDSNSSDREHKQTDSPPKLGLPTDLAQRQSSCLKLDIPFSI
FT                   QEESLGFGLDKEFDRVIESQKVAFHLALSQSPGSVPPSQAIAPNDCATPGNSAHPADSP
FT                   TPKQRGYLMRQNTKVIIASSRNEDEEALPSPERTAQDPRGTRSAGSSPRKPSQQTWTTV
FT                   PWNGSPRRPSIKPGNGVPKKKPVPGAGGVPPLPGQPSNVQEAPSTIGENEPAISESFED
FT                   GEERGRLFVKVVGLKYCDLPLPRGERSYFALTLDNGLHCVTTSWLEMGKSAPIGQEFEL
FT                   IVQNDLEFQLTLQMKIDESKFQTQEPAASPSRQKASALSRVFASPRRRKELDIKQQMQS
FT                   QQQKTKDVNAPVYERLRNLVARDGSFGRAYVALSDHEEQAFGRPHVVDVACFNEWAVEE
FT                   QMSSIKSKKSATSINTQRRPPYKIGKLEVQLLFVPKPKGSKDEDMPKSMNACIREMRDA
FT                   ESVASRSWEGFLSQQGGDCPYWRRRFFKLQGSKLTAFHETTRQPRATINLAKASKLIDD
FT                   RSSLLQKETSTKGGSRRKSAFAEEEDGYMFVEEGFRIRFGNGEVIDFYADSPADKEGWL
FT                   RVMSEAVGKGASSGNGALKPWADLVLKRERSMKTSNETAPRRPTSGIPTPAPPQSPVRS
FT                   RNSAMMGPPSSAGSGAPAPQSPRPRHKHTHSQPEIGSVEARRQKTRSLMF"
     atgggtaacg gatctggtca gcgaccactc tccgaagtga gccccatggc ccagaggcgt        60
     aattcgccta gctggaacca agtcacaaag atgccgcatg gcgaatcgcc tgcatacgat       120
     gtctcgtctc tgaataacaa taactccccg cgcctctttt ggaaaggtcg cgactccccg       180
     tcgccgtttc ccaagggagc cgagaataaa gcaccttatg atccagaggg gtgttatttc       240
     cccacgaagc gcccgtcact cgagaatttg aaacgcgtgt cgaaggtcaa aaatcacagc       300
     atgttcctcg aaggtggtca agagtatgac ccggcttcgg tagttttccc tcaccgacct       360
     ttggcctcag agaggtctcc acaacgggac agccaaatga atgttgcgaa gtcgcaattc       420
     gacgaagata ccactcagat ttctcgcccg tcatccccga gcaaagacca agcatcgcca       480
     agcaagtcct cgctatctaa aggtagccgg tacggcaaag gatttgaccc tcagaatgat       540
     atttggtccg agtatggcag tgccgggcat cgacatgcaa agagtgtcac atttgaccac       600
     gcccctcctc aagtcaatga atatgaaatg acaacaccgg atctttcctc agtcgcatcg       660
     gagtctcgag agaacagcta tgagtccgac gaagaggggg atcttagttt tgaggccgag       720
     tcatccattg agcgtgatga tagctttgac gcctcgctgg aagatatcga gaagacccct       780
     gttgtgttgc ccgaagactg gcgctttatg agcccaagca caaacagtga tggtgatccc       840
     ttcgtcgaag acgttgagga agacagcacc gagggccgac ctatctcacg tgaaggaggg       900
     tcttctcagc acacacgcgt tgaatcgctg gactcaaatg gcgagcgacg tcccctaccg       960
     cctttgccat cggtcaaccg cacctctggt gcgcgtccat cctcggctgg taagctcgct      1020
     gctgcctttg agctcggtag cgcgggccag cgtgtgcttc cttcacctcc ggctgctgct      1080
     tcatatacca agtctgatat ccccggcgct gggtccatag aggaaagact ccgtctcatg      1140
     atgctccagg aaagagatga tgattatgag aaatatgatg accacgccaa gaatatcgag      1200
     gaacccttgg agcttcctag agcagatgaa agccttacat caaaagacga tacccacaaa      1260
     gatgatgagg ccaaagagaa cttcttttct ccgcctcgta tttctcgcga ctcaattttg      1320
     cgaggtattc gcaagggtga cagctacgag gatgacagct tcgacgactc ttctcaaatt      1380
     gcttccagcc ccaaccgtta cgaccattat gaccctgatg ttcccattcc atccatggaa      1440
     accgatgatg atgacagctc cagtgtaatc attaaacagg aagagaacga tgaagacctg      1500
     tactctatca cggattatta tcagaacagg tcagacaaca gcctgtcgtc ccgtgaccaa      1560
     cgggccaaat atgacgagga cagcaattac tcgctacgtt ctgctgccga agccgccgag      1620
     cgcaaacacg ctggatatga cggtcacaaa gaggggtctg gagagactac ccctaacgct      1680
     gaaagccagg ccgacgccca aaagtctgca ccgctaaacg aagatgctaa ggcatgcaaa      1740
     gagccgaatg cccctcaaga ccagtcgttc gatatggcgt ctatccgcca gtctctcgca      1800
     cggcctctca cccctgagat gccgcaagac caagcttccg aaccttctac tccagactct      1860
     gtcattcgcc atcccattga ggacgaccac gaagaagacg acaataaaga agaagaggga      1920
     gaagtagagg aggaagagga gccggagcta gcgcatgatg agagctcatc cgacgagtct      1980
     gttcctgagc ccgtcgcaac cattcgagcc cctggtgctg gtcttaagac acgaccctca      2040
     ctgacccctg cggatatgca gtccatggcc gctacccgcc gtcagatcag tggccaacac      2100
     gctcctcccg tcccttcatt gaccaagcag atctccaatg actcgaactc ttcggaccgt      2160
     gaacacaagc agactgactc gccaccaaag ttgggccttc ccacggatct tgcccagcga      2220
     caaagcagtt gtttgaaact cgacattcct ttcagtattc aggaagaaag cctcggcttt      2280
     ggactcgaca aggagtttga ccgtgtcatt gaatcccaaa aggttgcgtt tcaccttgcc      2340
     ctttcccaaa gccccggttc tgtaccgccg tcccaggcaa tagcacccaa cgattgcgcc      2400
     accccaggaa atagtgcaca tcccgctgac tcccctaccc ccaaacagag aggatatctc      2460
     atgagacaga acacaaaagt gatcattgcc agcagccgta acgaagatga agaggctctg      2520
     ccttctcccg agcgcactgc ccaggacccg cgcggtacac gttctgcggg ctcttctcca      2580
     cgcaagccta gtcaacagac ttggaccact gtcccttgga acggctcacc gcgacgccca      2640
     agtattaagc ctggcaacgg tgttccgaag aaaaagcctg tccctggtgc gggtggagtc      2700
     ccacctctcc ctggacagcc cagcaatgtc caggaagccc cctcgaccat tggagagaat      2760
     gagcccgcta tctccgaatc cttcgaagat ggagaagagc gaggacgttt gtttgtgaag      2820
     gttgtaggcc ttaagtattg cgaccttcct ctcccacgcg gcgaacggtc gtactttgca      2880
     ctgacgttgg ataacggact gcactgtgtt accacctcct ggttggagat gggcaagtct      2940
     gctcccattg gacaggagtt tgagctcatt gtccagaatg accttgaatt ccagttgacc      3000
     ttgcagatga agattgacga gagcaagttc caaacccaag agcccgcagc atcaccatca      3060
     cgccaaaagg cctcggccct cagccgtgtg ttcgcatccc cacgccgccg caaggaactt      3120
     gacattaagc agcaaatgca gtcgcagcaa cagaagacca aggacgttaa tgctcctgta      3180
     tacgaacggc ttcgaaactt ggttgcgcgt gacggtagct ttggccgcgc atatgtagcc      3240
     ttgagcgacc acgaggagca ggcctttggc cgtccccacg ttgttgatgt tgcttgcttt      3300
     aacgaatggg cagtcgagga acaaatgagc agcatcaaga gcaagaagag cgcgactagc      3360
     atcaatacac agcgtcgacc accatacaag attggaaaat tggaagtgca gctgctcttc      3420
     gtgcctaagc cgaagggtag caaggacgaa gacatgccga agagcatgaa tgcctgcatt      3480
     cgcgaaatgc gtgatgcaga aagtgttgca tctcgctcct gggaagggtt cctttcccaa      3540
     cagggtggag actgtccata ctggcgccgt cgcttcttca agctccaggg atccaagtta      3600
     acggccttcc acgaaacaac gcgccaacct cgcgctacaa tcaacctagc caaggcctct      3660
     aaactcattg acgacagatc ctctctactt cagaaggaga ccagcacaaa gggcggttcc      3720
     cgccgcaaat ctgcatttgc cgaggaagaa gatggctaca tgtttgttga ggaaggattc      3780
     cgcatccgct ttggcaatgg tgaagtgatt gacttctatg cggatagccc cgcagataag      3840
     gagggctggc ttcgagtcat gtctgaagcc gttgggaagg gcgctagctc tggcaatggt      3900
     gcacttaagc cctgggctga tcttgtactc aagcgcgagc gcagcatgaa aaccagcaat      3960
     gagactgctc ctcgtcgtcc gaccagtggg attcccacac ctgccccacc ccaatctcct      4020
     gtccggagcc gaaacagtgc catgatggga cctccatctt ctgcaggatc tggggcgccg      4080
     gcgcctcaat ccccgcgtcc tcgccacaaa cacacccact ctcaacccga gatcggtagt      4140
     gtcgaagcgc gtcgacagaa aacgcgctct ctcatgttct aa                         4182
//

If you have problems or comments...

PBIL Back to PBIL home page