(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE418

PENCW_10.PE418       Location/Qualifiers
FT   CDS_pept        993806..994750
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000187209" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20672471"
FT                   /orf_name="Pc13g04180"
FT                   /product="Pc13g04180 protein"
FT                   /protein_id="CAP91487.1"
FT                   /db_xref="UniParc:UPI00018309F8"
FT                   /db_xref="UniProtKB/TrEMBL:B6H251"
FT                   /transl_table=1
FT                   /translation="MASAAVQLPASHGYLLSEKPGVPVSEKPHHVQTTLNFFKENEDGS
FT                   PPAPTYTSRPETYDRPAVSLAATIHDISGHELDYKLDTHGFQLYYHESQEKDFLDDEKI
FT                   KREYYAETEQLLKDAYATPKPISSHKTNIDLRSTGASRIFIFDHTIRRAPTDGSVGVRL
FT                   RGPVQRVHIDQSYTASKNRVSHHLPDEAAELLKGRYQIINVWRPIKTILKDPLAVADAH
FT                   SVPDSDLVPIGLIYPDREGETYGVKPDPNIKWYYRYGQTPDLVTLIKCFDSKVDGRARR
FT                   VPHTAFVNPETENEAGRESIEVRALVFHPDDRD"
     atggcttccg cagctgttca acttcccgct tctcatggct atctgctctc agaaaagccc        60
     ggagtcccag tttccgaaaa acctcaccat gtccagacca cactcaactt cttcaaagag       120
     aacgaagatg gttccccccc agcaccaaca tataccagca gaccagaaac atacgatcga       180
     cctgcggtct ctctcgcagc caccatccac gatatcagcg gccacgagct ggactacaag       240
     ctcgacaccc atggattcca gctgtactac cacgaaagcc aagagaaaga cttcctagac       300
     gacgagaaga tcaagaggga atactacgca gaaacagaac agctactcaa agacgcgtac       360
     gcaaccccaa aacccatatc ttcgcataaa actaacattg acctgcgcag caccggtgcc       420
     tcccgcatct tcatcttcga ccacacaatc cgccgagccc caaccgacgg atccgtcggt       480
     gtccgcctgc gcggacccgt acagcgcgtg cacatcgatc aatcctacac tgcctccaag       540
     aacagagtct cccaccatct gccagacgaa gcagccgagc ttctcaaggg ccgataccag       600
     atcatcaacg tctggcgtcc gatcaagacg attctgaaag atccattggc cgtggcggat       660
     gcgcactcgg ttccggatag cgaccttgtg cccatcggtc ttatataccc ggatcgggag       720
     ggcgagacat acggtgttaa gcccgatccg aatatcaagt ggtattaccg ctatggacag       780
     actccggatc tggtgacgct tatcaaatgt tttgattcga aggttgatgg gagagctcgg       840
     cgtgtgccgc atactgcttt tgttaacccg gaaactgaga atgaagccgg aagagagagt       900
     attgaagtgc gagcgttggt cttccatcct gatgaccgtg attag                       945
//

If you have problems or comments...

PBIL Back to PBIL home page