(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE419

PENCW_10.PE419       Location/Qualifiers
FT   CDS_pept        complement(995125..996000)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000234957" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19825164"
FT                   /orf_name="Pc13g04190"
FT                   /product="Pc13g04190 protein"
FT                   /protein_id="CAP91488.1"
FT                   /db_xref="InterPro:IPR008547"
FT                   /db_xref="UniParc:UPI00018309F9"
FT                   /db_xref="UniProtKB/TrEMBL:B6H245"
FT                   /transl_table=1
FT                   /translation="MAPQPIPFPGFTPISDRVYLRNGHEKSKPAPADEPTTIIISGWGD
FT                   GMPKHVTKYSDGYHELYPSARIIVILSRTFQATNQPEEVRIQAMMPVVDTVFPTPTGSG
FT                   NEKERVLVHAMSNTGAIFTASTVIAYQRRHGADKPFPHQLLVLDSTPGSLDFRSQATRW
FT                   SRAMAVGTAKFFPWPFVITHGLWYAFLWANYLWQVLRGAVSSGVWADRIINDKACVATD
FT                   SSRVYLYSKEDEIIGYKDLEENVAHTKTLGYSVDLEMFEGSSHVGHMRLHPEQYWNKIS
FT                   SSWKQAIAEK"
     atggctccac aacccattcc attcccgggc ttcaccccga tatcagatcg tgtatacctt        60
     cgcaacggcc acgagaagag caagcccgcc ccagccgacg aaccaacaac aatcatcatc       120
     tccggctggg gcgacggcat gccgaaacac gtcaccaagt actccgacgg ctaccatgaa       180
     ctgtacccat ccgcgcggat catcgtcatc ctatcgcgta ccttccaagc cacgaaccaa       240
     cccgaggaag tccgaatcca agccatgatg ccagtcgtcg acaccgtctt cccaacgcca       300
     accggcagcg gaaacgaaaa ggagcgcgtc cttgtacatg ccatgtcgaa tacaggcgcc       360
     attttcaccg catcaaccgt tatcgcatac cagcgtcgcc acggcgcaga caagccgttc       420
     ccgcaccagc tcctggtgct ggattccacg ccgggaagtc tggacttcag gtctcaggct       480
     acgcggtggt cgcgggccat ggcagtcggc acagccaagt tcttcccttg gccgtttgtt       540
     atcacgcatg gtctgtggta tgctttcctc tgggcgaatt acctgtggca ggttctgcgc       600
     ggggctgttt cgtcaggtgt gtgggcggac cgcatcatca atgataaggc ctgtgttgcg       660
     acggattcga gtagggttta cctttactct aaggaagatg agattattgg gtataaggat       720
     ttggaggaga atgttgccca tactaagact ttgggctact cggttgatct tgagatgttt       780
     gagggctcgt cgcatgtggg acatatgaga cttcatccgg aacagtattg gaataagatt       840
     tccagttctt ggaagcaggc catcgcggag aaataa                                 876
//

If you have problems or comments...

PBIL Back to PBIL home page