(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE420

PENCW_10.PE420       Location/Qualifiers
FT   CDS_pept        join(997568..997755,997854..997965,998016..998728,
FT                   998777..1000166)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000182535" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15950898"
FT                   /orf_name="Pc13g04200"
FT                   /product="Pc13g04200 protein"
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP91489.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniParc:UPI00018309FA"
FT                   /db_xref="UniProtKB/TrEMBL:B6H246"
FT                   /transl_table=1
FT                   /translation="MKVAIPRQRFIVAPPSNKRVSRACETCRQRKIKCNGKTPTCRQCE
FT                   ETNSSCVYPLKSRERTTRQIESFHQQVQDYESMLKDIGNLVDGQSAKRIKDLLQKYNAD
FT                   SDDGSNSTPDVSHDRNGSKRSPSPSSVGSLEAVDRVEEDLNLTESSRATGYMGKSSEIT
FT                   WMGRVQEGTEQRSRGQSPKAASEDHTNDKVAPSAVNYHIDDIGVDAPGPVQMYWVPPRQ
FT                   VADHLFETYLRAVHPHFPIINSTLFSTQYRDFFDDRSYPGDKWLAILNMIFAIAAEYLY
FT                   NSDGTQRGDIKDHLFYLTRARMLSMGGDSLFEHPDLQQVQIEGLIAFHMLSTNQVNRAW
FT                   KISALAIRSATSLGINLKSSCHKMLGVSKEIGCRIWWCLYTVEHTLGSMTGRATSISTN
FT                   MYTTQLPLPFDEDHLPEPTATMLLGDLDERAKRVDMAMTSPYIRHPDLQPSEDTPAARS
FT                   WLQSLPVNPSLYFLYYCDLAVVNQEILDHVYSPESATISWEDIKSRTSRLRTTVDAWVS
FT                   SLPPGLDFASVKDENQQSYWAKTNLAFHYYNTRIMLGRPSLCRHSRADRGRKSVEQRGF
FT                   SHDMAVMTLESAMHMLDLLPNKPSMRHIYRFCPWWCFLHYIMKTATVIILELSFHCVHA
FT                   PDRESDLVESAKKSVRWLHMMSINCIASHRAWQLCESAVRRLVSSMGYDDSDIPPPPKR
FT                   QRGDQFGDNGAVPPGQHNGTAGGGQVLPYNGQGQSSVLPHESHAMDHSNNNPDLTGSLA
FT                   FGFLATPSSQDHTDGYFPYDPISEEFLRYFFPALDGEANPSGERNTF"
     atgaaagtcg caatcccccg gcaacgtttc atcgtcgcgc cgccgtccaa caaacgagtc        60
     tcacgagcgt gcgaaacatg tcgtcaacga aaaattaaat gcaacggcaa gaccccaact       120
     tgcagacaat gtgaagaaac gaatagttca tgcgtctatc cgctaaagtc gcgtgagaga       180
     acgacgaggc agatcgaaag ctttcaccaa caggtgcagg actacgagtc tatgttgaaa       240
     gacataggga atctagtcga cgggcaatct gcgaagcgta ttaaagactt actccagaag       300
     tataacgccg attcagacga tgggtctaat tcaacgcccg atgtgtctca cgatcggaat       360
     gggtccaagc gatccccttc accttcttcc gttgggtccc tagaagcggt ggaccgagtc       420
     gaggaagacc tcaatttaac agaaagctcc cgggcgactg ggtatatggg caagagttca       480
     gaaataacgt ggatgggccg tgtgcaggaa gggacagagc agcgcagtcg cggtcaatca       540
     ccaaaggctg cgtcggaaga tcataccaat gacaaggttg ctccatccgc ggtcaactat       600
     catattgatg atattggcgt tgatgcacca ggaccggtgc aaatgtactg ggttcctcct       660
     cgacaggtgg cagatcatct gtttgagact tacctgcgcg ctgttcaccc gcatttccct       720
     atcatcaaca gcactctgtt ttccacccaa tatagggact tcttcgacga tagatcttat       780
     ccgggtgata aatggctggc gatattgaac atgatattcg ccattgcggc agaatatttg       840
     tataacagtg atgggacaca gcggggggat atcaaagacc atctcttcta cttaacacga       900
     gccagaatgc taagtatggg cggcgacagt ttgtttgaac atcctgatct tcaacaagta       960
     caaatagagg gattgattgc atttcacatg ctatctacaa accaggttaa tagggcgtgg      1020
     aaaatctcag ctttagcaat tcgatccgcc acctcccttg gcattaatct gaagagcagt      1080
     tgccacaaaa tgctaggcgt gtcgaaggag ataggctgcc gaatctggtg gtgtctctac      1140
     accgtcgaac acacgctagg ctcgatgact ggtcgtgcaa cctccatttc gaccaatatg      1200
     tataccaccc aactacccct tcctttcgac gaggatcatt tgccagagcc aacagctaca      1260
     atgcttctcg gggacctgga tgaaagagcc aaacgcgtgg acatggccat gactagcccg      1320
     tacattcgcc atcccgacct gcagccgagt gaagatacac cggctgcgcg ctcgtggctt      1380
     caaagtctgc cagtcaatcc cagtctttac ttcctatact actgtgatct cgcagttgtg      1440
     aaccaagaaa ttctagacca cgtctactca ccagagagtg cgacgatatc atgggaagat      1500
     atcaagagca ggaccagccg actgaggaca accgtcgacg catgggtatc gtctcttcct      1560
     cccgggctgg atttcgcttc tgtgaaagac gaaaatcaac aatcctactg ggcgaagacg      1620
     aacttggcat tccactatta taatacccga atcatgcttg gtcggccgtc tctctgccga      1680
     cacagtcggg ccgacagagg acggaagagt gttgagcagc ggggattcag tcacgacatg      1740
     gctgtgatga cactggagtc cgccatgcac atgctcgatt tgttgcccaa caagcccagc      1800
     atgcgccata tatatcggtt ttgtccatgg tggtgtttcc tacactatat catgaagaca      1860
     gcaacagtta tcatacttga gctgtcattt cactgtgtgc atgcgccaga ccgagaaagt      1920
     gatttggttg agtcggcgaa gaaatctgtc cggtggcttc acatgatgtc cattaattgc      1980
     atcgcgtcgc atcgtgcatg gcaactttgt gaaagtgcag ttcgccgact ggtgtctagc      2040
     atggggtacg acgatagtga cataccaccc cctccaaaga ggcagcgcgg cgaccagttt      2100
     ggcgataatg gcgctgtacc gcctgggcag cacaatggaa cagctggtgg tgggcaggtc      2160
     ttaccttaca acggccaagg ccaatcatca gttcttcccc atgaaagtca tgccatggac      2220
     cattccaata acaacccgga cctcacgggt tctttagcgt ttggattttt agcgacgcca      2280
     agttcccaag atcacactga tggatatttc ccttatgacc ctattagcga agagttcctt      2340
     cgttatttct tccctgccct ggacggagag gcaaacccga gcggcgaaag gaatacattc      2400
     tga                                                                    2403
//

If you have problems or comments...

PBIL Back to PBIL home page