(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE421

PENCW_10.PE421       Location/Qualifiers
FT   CDS_pept        join(complement(1000982..1001061),
FT                   complement(1000308..1000869))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15950899"
FT                   /orf_name="Pc13g04210"
FT                   /product="Pc13g04210 protein"
FT                   /protein_id="CAP91490.1"
FT                   /db_xref="UniParc:UPI00018309FB"
FT                   /db_xref="UniProtKB/TrEMBL:B6H247"
FT                   /transl_table=1
FT                   /translation="MSPTYKKMFEARQTFKPVRRYGQPDGRKPSREKSEYWKNSQRTTE
FT                   NDEDEERLRLCYEELETVKRNHSQNEQKMFADESMIPPGPLKRDYDAMRQDPTWYLRKE
FT                   LIEDCFGRGCCCARGCDCCRNRASAYYKRGVGHCTTDCGCCASERGFEYTAGEKQQIVE
FT                   QFDKMLRSRNPSYIVKMAEAYFVKPLEQKVLEQVQKKKVQKKRVWWKQLL"
     atgagtccaa cgtataaaaa gatgtttgaa gctcgtcaga cattcaagcc agtgagacga        60
     tacgggcagc cggacggcag gaaaccctcg agagaaaaat ccgagtactg gaaaaactcc       120
     cagagaacga cagagaacga cgaggacgag gaacgccttc gactttgtta tgaagagcta       180
     gaaaccgtca aacgaaacca cagccagaat gagcaaaaga tgttcgccga tgaatcgatg       240
     atcccgccag ggcccttgaa acgggactac gacgccatga gacaagatcc aacctggtat       300
     cttcggaaag agttaatcga ggactgcttc ggcagaggct gttgctgcgc gcgtggttgt       360
     gactgctgca ggaatcgtgc atccgcttat tataaaaggg gggtgggaca ttgtacaacg       420
     gattgtgggt gctgtgcaag tgagaggggg tttgaatata ctgctggaga gaagcagcag       480
     atcgtagagc agtttgataa gatgcttcga tcgcgtaatc cgtcgtatat cgttaagatg       540
     gcggaggctt attttgttaa accgctggaa caaaaggtac tggaacaagt acagaagaaa       600
     aaggtgcaga agaaaagggt atggtggaag cagctgcttt aa                          642
//

If you have problems or comments...

PBIL Back to PBIL home page