(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE422

PENCW_10.PE422       Location/Qualifiers
FT   CDS_pept        join(complement(1002903..1003218),
FT                   complement(1002354..1002486),complement(1002209..1002302),
FT                   complement(1002094..1002153),complement(1001794..1002030),
FT                   complement(1001425..1001724))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000185578" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18129531"
FT                   /orf_name="Pc13g04220"
FT                   /product="Pc13g04220 protein"
FT                   /function="hydrolase activity"
FT                   /protein_id="CAP91491.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR013831"
FT                   /db_xref="UniParc:UPI00018309FC"
FT                   /db_xref="UniProtKB/TrEMBL:B6H271"
FT                   /transl_table=1
FT                   /translation="MRLGRTFTTFLSWALVASATILENGQVRENSYPGQLEPVTLDDSW
FT                   RDYPADAPEISYKGRWDSQHISCMFPIRFLFPRLLFLTLTLTLERTSGWSYVLQLSPIL
FT                   SLSPCRSTCSSLTIHTVQIAGVAVAKDAVLTKPPTFEKRVEIIGGSLASGQFATYETIS
FT                   SWSFLFANGLGNVEYGITAYPGVCLADEQCYGGSSRGVGWYWHRASDPGSRARAMYDHS
FT                   PEKWDVKAEQPADLVIIQMGGNDHRHPNEIPGRDYYHAYVELVEDIHSNWPNAIILLMS
FT                   QWGTFSKEGKKYVGSTYYQEETRQVNEHFKDRGFVYYFPTEGLLQHNDINPKNHLTDVG
FT                   HIKVASHLLQWVKLVLRWNLEPTGEVQSGTTYWNDQQEY"
     atgcggcttg gacgtacatt cacgactttt ctctcatggg ccttggttgc ttcggccacc        60
     attctcgaga acggtcaagt cagagagaac tcatatcctg gccagttaga accggtgact       120
     ctggacgatt catggagaga ctaccccgcg gatgccccgg agatctcata caaaggtcga       180
     tgggatagcc agcacatttc ctgtatgttc cccatccggt tcctcttccc cagactctta       240
     tttttaacct taacactaac cttggaacga acttcagggt ggtcgtatgt attacaactc       300
     tctcctattc tgtccctctc cccctgtcgt tcaacctgtt cgtcactgac catccacaca       360
     gtccaaatcg caggcgtagc tgtcgcgaaa gacgctgtcc tcaccaagcc cccaaccttc       420
     gaaaagagag tcgagatcat cggcggctcg cttgcatccg gacaattcgc cacctacgag       480
     acgatctcct catggtcctt cctcttcgcc aacggcttgg gcaatgtcga atatggcatc       540
     acagcctatc ccggcgtgtg tctcgccgat gaacaatgtt acggcggcag ctctcgcggc       600
     gtgggatggt actggcaccg cgcctccgac cccggctctc gcgcacgtgc aatgtacgac       660
     cacagcccgg agaagtggga cgtgaaagca gagcaaccgg ccgatctggt gatcatccag       720
     atgggcggta acgatcaccg ccatcccaac gaaatccccg gccgggatta ctatcatgcc       780
     tacgtcgagt tggtagagga tatccactcc aactggccta atgcgatcat cctcctcatg       840
     tcccaatggg gaactttctc caaagaaggc aagaagtacg tcggtagcac ttactaccag       900
     gaagagactc gccaagtcaa tgagcacttc aaggaccgtg gtttcgtcta ctatttcccc       960
     accgagggtc tgctgcaaca taacgatatc aaccccaaga accatcttac ggatgtggga      1020
     catatcaagg ttgcgagcca cttgttgcag tgggttaagt tggttctgag gtggaacctt      1080
     gagcccacgg gtgaagtgca gtctggaact acgtactgga acgatcagca ggaatactga      1140
//

If you have problems or comments...

PBIL Back to PBIL home page