(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE423

PENCW_10.PE423       Location/Qualifiers
FT   CDS_pept        join(1005634..1005747,1005799..1006426,1006481..1007184)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076581" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15950900"
FT                   /orf_name="Pc13g04230"
FT                   /product="Pc13g04230 protein"
FT                   /function="transferase activity, transferring acyl groups
FT                   other than amino-acyl groups"
FT                   /protein_id="CAP91492.1"
FT                   /db_xref="GO:0016747"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniParc:UPI00018309FD"
FT                   /db_xref="UniProtKB/TrEMBL:B6H272"
FT                   /transl_table=1
FT                   /translation="MEYIQPNHLYSRILDNIPWKSADPSVKGDPRKSVKWIDGLRGIAS
FT                   FLVILTHLARAWDYDLFAPRDDVDKPPRILQWPVFRIPWQGRLGVTIFAFLTGYVCALK
FT                   PLKQSRNGDILGSFTSVGKSAFRRPPRLIFPATIALIISWVMAQCGAFIAANRSDCWWC
FT                   RYAAVDLAPTFWEEFVRLFKTFLEVWTTGYMAYDDHQWALLPLLQASMLIYILVCATMF
FT                   CKFRFRVAIYLGMYLYFHQNAAKNTETFQMQAIYGMFLSDLSYEKGFKEFVERHSWGRK
FT                   IVAGILLCLGLFICSYPGEHPEWATWSSYMEQASHYIFPPKVNVGKRYSALGVDLIIFA
FT                   IYISPSTKEFLSSSLLLWLGKQSFAVYLVHGTLLRTVLCWMLYGITGQPWEGDIVDEKG
FT                   NPIYGEDGEPLHPHWIPIRAPWVVAISIPSWIVLVYFCATLWTGYVDPFCARMAQKLEK
FT                   WMFEEDEQAPPPLPMTSIPMQTA"
     atggagtata tccagccgaa ccatctatac tcccgcatat tggacaacat cccctggaag        60
     tcggcagatc catcggtgaa aggtgatccg cggaaaagtg tcaagtggat tgacggccta       120
     cgaggaatcg cttcattcct agttatcctc actcaccttg ccagagcatg ggattatgac       180
     ctctttgctc cccgcgacga tgttgacaaa cctccccgaa ttctgcagtg gcccgtcttc       240
     cgtattcctt ggcaaggccg tttgggtgtc actatattcg ccttcttgac tggctacgta       300
     tgtgccctta agccgctcaa acagtctcga aatggcgata tcctcggatc tttcacttcg       360
     gttggcaaga gtgccttccg ccgcccacct cgtctcatct tccccgcgac tatcgccttg       420
     atcatctcat gggtcatggc gcagtgcggc gccttcattg ccgctaaccg ctccgactgt       480
     tggtggtgcc ggtacgcagc cgtcgatctg gcgcctactt tctgggagga gtttgtccgg       540
     ttattcaaga ccttccttga agtctggact acgggatata tggcctatga tgaccaccag       600
     tgggctttac ttccgctgct ccaggcatct atgttgattt atatccttgt ctgcgcaaca       660
     atgttttgca agttccgatt ccgcgtggcc atctacctcg gcatgtacct ctatttccac       720
     caaaacgccg caaagaacac cgaaaccttc caaatgcagg caatttacgg catgttcctc       780
     agcgacctct cctacgagaa aggattcaaa gaattcgtcg aacgccatag ctggggccgc       840
     aagatcgtag ccggcatcct tctctgcctc ggcctcttca tctgctcgta ccccggagaa       900
     caccccgaat gggccacatg gtcttcctac atggaacagg cctcacacta tatcttccct       960
     ccgaaagtca acgtcggcaa gcgctactcc gccctgggcg tcgacctcat cattttcgcc      1020
     atctacatct ccccttctac gaaggagttc ctctctagta gtctcctcct ctggctcggc      1080
     aaacagagtt tcgccgtcta cctcgtgcac ggcactcttc tccgcaccgt tctgtgctgg      1140
     atgctttacg gaattactgg ccagccctgg gaaggtgaca tcgtcgacga aaagggtaac      1200
     ccgatctacg gcgaggatgg cgagcccctc cacccgcact ggatccccat ccgtgcccct      1260
     tgggtcgtgg ctatcagtat cccgtcttgg attgtgctgg tctacttctg tgctacgttg      1320
     tggactggat atgttgatcc gttctgcgcg cgcatggctc aaaagttgga gaagtggatg      1380
     ttcgaggagg atgagcaggc tccgcccccg ctgcctatga ctagcattcc tatgcagaca      1440
     gcttaa                                                                 1446
//

If you have problems or comments...

PBIL Back to PBIL home page