(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE424

PENCW_10.PE424       Location/Qualifiers
FT   CDS_pept        join(1007962..1008250,1008332..1008471,1008576..1008636,
FT                   1008882..1009029,1009221..1009332,1009386..1009448)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15950901"
FT                   /orf_name="Pc13g04240"
FT                   /product="Putative uncharacterized protein Pc13g04240 "
FT                   /protein_id="CAP91493.1"
FT                   /db_xref="UniParc:UPI00018309FE"
FT                   /db_xref="UniProtKB/TrEMBL:B6H273"
FT                   /transl_table=1
FT                   /translation="MNEGRCVASFAVISANPRIVLTPVTAIVDFLSVHDVQCTMWVIAV
FT                   RKPRYDGNVFLFLFGFCSTARSKINSRARELSFLVSASTAPVCSASGPRTSAPIQRVYF
FT                   RRKFVAVYRFGLGKNRPCSPGGEVGIQWGWMIISPYRTSLRGFCSHGLEVFVSTITLSA
FT                   WYGSAKLCVVSVEDGCAILAMFPNIVLEACRSSLHFHDLSMMAEGCPYAGVALSSFAFP
FT                   NGGYPWATGTSRHRGLMTPEVAILMLNEQIEGVCAGYPFPARRLSSQI"
     atgaacgaag gacgatgtgt tgcatccttt gctgtcatat ctgccaatcc gagaatcgtc        60
     ttgacccccg tgacagctat tgtggatttc ttgtccgtac acgatgtaca atgtacaatg       120
     tgggttatag cggtacggaa accccgttat gacggaaacg tgttcctatt cctgttcggt       180
     ttctgttcca cagctcgttc gaaaattaac tctcgggcgc gagagctgag cttcttggtc       240
     tccgcttcga ctgccccagt ctgctccgct agcggaccga ggacttccgc gccgatccaa       300
     cgtgtctact tcagaaggaa gtttgttgcg gtttatagat tcggtctcgg gaaaaaccgt       360
     ccatgttcac ctggcggaga ggtcgggatt caatggggct ggatgatcat ctcgccttac       420
     aggacttcgc ttaggggttt ttgttcccat ggtctcgagg tgttcgtctc tacaataacg       480
     ctgagtgcat ggtatgggag cgccaagctt tgcgttgtat ccgtggaaga cggctgtgct       540
     atcctggcga tgttcccgaa tatcgtcctc gaggcgtgtc gcagttccct ccatttccat       600
     gacctgtcaa tgatggctga gggttgtcca tatgctggag tggcgttgtc atcttttgca       660
     ttcccgaatg gaggttatcc atgggcgact ggtaccagtc gtcatcgtgg gttgatgact       720
     ccagaggtag caatattgat gctcaacgag caaatcgaag gggtgtgtgc gggttatcca       780
     ttcccagcca gaaggctaag cagccagata tag                                    813
//

If you have problems or comments...

PBIL Back to PBIL home page