(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE425

PENCW_10.PE425       Location/Qualifiers
FT   CDS_pept        join(complement(1010944..1010967),
FT                   complement(1010611..1010718),complement(1010487..1010547),
FT                   complement(1010197..1010381))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19825165"
FT                   /orf_name="Pc13g04250"
FT                   /product="Putative uncharacterized protein Pc13g04250 "
FT                   /protein_id="CAP91494.1"
FT                   /db_xref="UniParc:UPI00018309FF"
FT                   /db_xref="UniProtKB/TrEMBL:B6H274"
FT                   /transl_table=1
FT                   /translation="MADDSQHPLWCKHCEVEGHLVIHCHALYEELTNFDAAFKMAQGQA
FT                   SDPKNAYPVARWGQAKKKKDVSVPGINCPSNPFAHLSPWEADTLANYPEQQWAYWMQWE
FT                   ADALASYLDQKWTYFLQWHAA"
     atggctgacg atagccagca ccctttgtgg tgcaaacact gcgaagtgga gggacacttg        60
     gtcatccact gtcatgctct ctacgaagag ctgaccaatt tcgacgcggc cttcaaaatg       120
     gcccagggcc aggcttctga cccgaaaaat gcctatccag ttgcccgttg gggccaggca       180
     aagaagaaga aggatgtgtc cgttcctggc atcaactgcc cgtcaaaccc tttcgctcat       240
     ctcagcccat gggaggctga caccctggcg aactaccccg agcaacaatg ggcatattgg       300
     atgcagtggg aggccgacgc ccttgccagt taccttgatc agaaatggac ctattttctg       360
     cagtggcatg ctgcgtaa                                                     378
//

If you have problems or comments...

PBIL Back to PBIL home page