(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE426

PENCW_10.PE426       Location/Qualifiers
FT   CDS_pept        join(complement(1016455..1016788),
FT                   complement(1016062..1016396))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000158704" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18129532"
FT                   /orf_name="Pc13g04260"
FT                   /product="Pc13g04260 protein"
FT                   /protein_id="CAP91495.1"
FT                   /db_xref="InterPro:IPR003807"
FT                   /db_xref="UniParc:UPI0001830ACF"
FT                   /db_xref="UniProtKB/TrEMBL:B6H281"
FT                   /transl_table=1
FT                   /translation="MTEPSQPPVPEEPPNAVLNDSRPTSARDSRDDDREALELHTIQTR
FT                   EDDELDYSTASASSGEEHRVPTNRITSRPDSQRRLEARKGLWGKICRLWTRNVVITVPQ
FT                   KSNRDHFALERTFLAYIRTSTVIAMQGVLVAQLFRLQRPPEKANRHRLTFYELGIPLSV
FT                   ACHIVAVIVALIGAVRFFRQQNAIVRGKVHAGGWELYSVGFLLFLVSSFSLGRCWISGF
FT                   "
     atgactgagc ccagtcaacc ccctgttccc gaggaaccgc ccaacgcagt cctgaatgac        60
     tcccgcccga cttccgctcg cgactcccgt gatgacgacc gggaagcatt agagctccat       120
     acaatccaga cccgcgaaga cgacgagcta gattactcta ctgcgtcggc ttcgtctggc       180
     gaggagcacc gtgtgcccac aaatcggatt acgtcccggc ccgattccca gcgcagactt       240
     gaagcccgca agggcctttg gggcaagatc tgtcggttat ggacccggaa tgtcgtcata       300
     acggtaccgc agaagagcaa tcgagatcac tttgccctgg aaagaacgtt ccttgcgtac       360
     atccgcacat caacggttat cgctatgcag ggggtactcg ttgctcaact cttccgttta       420
     caacggccgc cggagaaagc taatcgccat cgtctaacgt tctatgaact cggtatccca       480
     ctttcggttg cctgtcacat tgtggctgtt atcgtcgcct taataggtgc ggtgcgattc       540
     ttcagacaac aaaatgctat tgttcgtggg aaagtgcatg ctgggggatg ggagttatac       600
     tcagtaggat tcttattatt ccttgtaagt tctttctccc taggacgatg ctggatctct       660
     ggattctga                                                               669
//

If you have problems or comments...

PBIL Back to PBIL home page