(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE427

PENCW_10.PE427       Location/Qualifiers
FT   CDS_pept        1018213..1020765
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000251716" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18129533"
FT                   /orf_name="Pc13g04270"
FT                   /product="Pc13g04270 protein"
FT                   /function="aminomethyltransferase activity"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="glycine catabolic process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAP91496.1"
FT                   /db_xref="GO:0004047"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006546"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR006222"
FT                   /db_xref="InterPro:IPR013977"
FT                   /db_xref="UniParc:UPI0001830AD0"
FT                   /db_xref="UniProtKB/TrEMBL:B6H282"
FT                   /transl_table=1
FT                   /translation="MSLSQRVVIIGAGIVGTNLADELVSRGWSDITVVEQGPLHMPGGS
FT                   TSHAPGLVFQTSPSKTMTHLARYTVEKLLSIEKDGHKCFNQVGGLEVATTPARLEDLKR
FT                   KHGYASSWGIEARLVSAEECYKMYPHLNNEMVLGGLHIPSDGLALAARATQLLIERTSK
FT                   AGVRYLGHTPVTGIERDGRRVTGVSTPSGTIPADIVVSCAGFWGVELGAMVGVEIPLLP
FT                   LAHQYAKTTAVPALAGRGINNMINGMNATLPILRHQDKRLYYREHGGQYGIGYYGHRPM
FT                   PVVAASLGLTPKEVDEKNMPSRLEFTTEDFDPAWKESQKLLPALQNTEIADGFNGVFSF
FT                   TPDGGPILGQPSHLDGFYVAEAVWVTHSAGVARALAQILTTGRSDIDVSECELSRFEEV
FT                   QLNRDYVSETGQQNFVEIYDIIHPLQQRESPRNLRVSPFYAREVELGAVFFETGGWERP
FT                   WWYEANKDLVKSLPPSWQPVERDSWSAQLHSPISAAEAWKTRNAVAMFDMTAFHRFDVR
FT                   GPGAVGLLQRLTTSDITTKPGTVTYTLLLNDHGGIRGDIFVLRLDDDVFQIGANTATDL
FT                   AYLTREARVHEQNTPGQWTEVRDVTGSTCCIGLWGPRARDVIAGITTVDVSNKGLPYFS
FT                   LKKTVIQGIPVTLIRKSYVGELGWEVQTSAEYGQRLWDTIWQAGKLHGLIAGGRSAFNS
FT                   MRLEKGYRTYGVDMTTEHNPFEAGVSYAVDANKKDDFVGKAALQRLSKQVPSRRLRALT
FT                   VDDGRSMILGKEPVFHNGKAAGYVTTAAFGYTIGKPIAYAWLPGYLREGETVEIEYFGK
FT                   RIRATVEAESLYDPEMNRLRQDSLPSATGPETAFMSRL"
     atgtcccttt cacaacgcgt tgtcatcatc ggagccggta tcgtaggcac caacctcgcc        60
     gacgagctgg tctctcgagg atggagcgat atcactgtcg ttgagcaggg cccgttgcac       120
     atgccaggcg ggtcgacgtc acatgccccg ggactcgtat ttcagacaag cccgtccaag       180
     acaatgacac acctcgcacg atacacagtc gagaagcttc tatcgataga gaaggatgga       240
     cacaagtgct tcaatcaagt gggcggtctc gaagtagcaa ccacacccgc acggctggag       300
     gatctgaagc ggaaacatgg atacgcctcg tcatggggca ttgaggcacg gctggtcagc       360
     gcagaggagt gctacaagat gtatcctcat ctgaacaatg agatggtatt gggcggtctg       420
     catatcccca gtgatggtct cgcgctagca gctcgagcaa cacaactact cattgaacgg       480
     accagcaagg ccggtgtgcg ttatctgggc catactcccg tgacaggaat tgagcgggac       540
     ggccgtcgcg tcaccggagt cagtactcca agtggcacta tcccggcaga cattgttgtc       600
     tcttgcgctg ggttctgggg tgttgaattg ggagccatgg tcggcgtgga aattcctttg       660
     ctcccgctgg cacaccaata tgcaaagact acggcagtac ctgctctcgc tggtcgaggt       720
     atcaacaaca tgatcaatgg aatgaatgcc acactgccaa tcctccgaca ccaggataag       780
     cgtctctact accgtgaaca tggcggacag tacggcattg gatattacgg acaccgtcca       840
     atgcccgtcg tcgcggcatc ccttggactc acacctaaag aggttgacga aaagaacatg       900
     ccctcccgcc tcgaattcac aaccgaagac ttcgacccag cttggaagga gtctcaaaag       960
     ctcctccccg ccctccagaa tacagaaatc gcagatggct tcaacggtgt cttttccttc      1020
     acacccgatg gcggtccaat cctcggccaa ccatcccatc tcgacggctt ctacgtagcc      1080
     gaagctgtgt gggttacaca ctccgcaggc gtcgcccgag cgctagccca aatactcaca      1140
     accggccgat cggacatcga cgtgtcagaa tgtgagcttt cccgcttcga agaagtacaa      1200
     ctcaatcgcg actacgtcag cgagaccgga cagcagaact tcgtcgaaat atacgacatt      1260
     atccacccgc tccagcagcg ggagtcgcct cgcaatttgc gtgttagtcc attctacgcc      1320
     cgtgaggtgg agctaggggc tgtcttcttc gagactggtg gctgggagcg gccgtggtgg      1380
     tacgaggcaa acaaagatct tgttaaatct ctccctccat cgtggcagcc tgttgaacgg      1440
     gattcctggt cggcgcagct tcattcgcct atttctgctg ccgaggcgtg gaagacgcgg      1500
     aatgctgttg ctatgtttga tatgactgct ttccatcgat ttgatgtgcg cggtcctgga      1560
     gcagtgggtc tcctccagcg gctgaccacg agtgacataa ccaccaagcc aggcaccgtt      1620
     acttataccc tcctcctgaa tgaccacggt ggtattcgcg gggacatctt tgttctacga      1680
     cttgacgatg atgtgttcca gatcggagca aacactgcaa ccgacctcgc gtacctcacc      1740
     agagaagccc gagtgcacga acagaacaca cccggacaat ggaccgaagt ccgcgatgta      1800
     acaggcagca catgctgcat cgggctatgg ggtcctcgag cccgggatgt gattgccgga      1860
     ataaccacgg tcgacgtttc caacaagggc cttccctact tcagtctcaa gaaaacagtt      1920
     attcagggta tcccagttac actgatccgg aagtcctacg tcggcgaact aggctgggaa      1980
     gtccaaacca gcgccgagta cggacaacgt ctatgggaca caatctggca agctggaaag      2040
     ctgcacggac tcattgccgg aggccgcagt gcgtttaact caatgcgtct cgagaagggg      2100
     taccggacct acggcgtgga tatgacgacg gagcacaatc cgttcgaggc tggtgtttcc      2160
     tacgccgtgg acgcaaataa gaaagatgac ttcgttggta aagccgccct tcaacgtctt      2220
     tctaagcaag taccttcgcg gcgactacgg gctttgactg ttgatgatgg tcgctcgatg      2280
     attcttggca aggagcctgt tttccacaat ggtaaagcgg ctggctatgt aaccaccgct      2340
     gcatttgggt acacgattgg taaaccaatt gcctatgcct ggcttcctgg gtatttgcgc      2400
     gaaggtgaga cagtggagat tgagtatttc ggaaagcgca ttagggcgac tgtcgaggcc      2460
     gagtcgcttt atgaccctga gatgaatcgt ctcagacagg atagcttgcc ttcggcgact      2520
     ggaccagaga ccgcgttcat gtcacgactt tga                                   2553
//

If you have problems or comments...

PBIL Back to PBIL home page