(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE428

PENCW_10.PE428       Location/Qualifiers
FT   CDS_pept        join(complement(1022513..1022743),
FT                   complement(1022111..1022405),complement(1021054..1022057))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15950902"
FT                   /orf_name="Pc13g04280"
FT                   /product="Putative uncharacterized protein Pc13g04280 "
FT                   /protein_id="CAP91497.1"
FT                   /db_xref="UniParc:UPI0001830AD1"
FT                   /db_xref="UniProtKB/TrEMBL:B6H283"
FT                   /transl_table=1
FT                   /translation="MVTSSIFPLEIWLMIFQYLRDEESPQHISRLAQTCKSFHQELNHL
FT                   LYHPVRLRRVENARHFANTISSRPDLAALVKENLPPSDDGHTPQAEVQAVFTDIYYQNQ
FT                   DFHMRDCEDDLLALMMWMDDKGYPLGDASDPFGLGFNPLGHFSFQSWAEDLSEYTYFGQ
FT                   NYLKDLIPALQTCHIGTDSDLDPIHNAGKYQPYVEFNETIFTLPHLRKLCITGVTFRDF
FT                   GLKDELIEHRTTNLKELLLLNCGISTENLELIIRFPRALERLTIRVPVSLLSEYEEEDY
FT                   LSFSGELSARHAESLEYLDLDIYGGLDVGFGLDYFDVLKEIVITPHSVIKDHDGETVLT
FT                   SSLQRLTIRYEEGTGLLLDDIFNQVETAKLPNLRSVICQIPDNLCEGTTSSAVRVEAEA
FT                   FKSLFKDLGVELSTELVPYPLTMPKYDVCPCENLTFYHQFPFHPRPKPRPQNVPASYSN
FT                   PMPMPVVHDSDPYDGDYPYLYDMSPPSPPRMPTSMPTFMDYDDYLDWMYGG"
     atggtcacat cgtcaatttt tccgctggaa atttggttga tgatctttca gtatcttcgc        60
     gacgaagaaa gcccacaaca catcagcagg ctcgcacaga catgcaaatc ttttcatcaa       120
     gaacttaatc atcttctata ccaccctgta cggctgaggc gggtagagaa tgctcgccac       180
     ttcgccaata ccatctctag tcgcccagac ttagctgcac ttgtgaagga aaatctccca       240
     ccaagtgatg acgggcacac gccacaagcg gaagtacagg cagtgtttac cgatatttac       300
     taccaaaacc aggacttcca catgagagat tgtgaggatg atctactggc tctcatgatg       360
     tggatggacg ataaagggta ccctctgggt gacgcatcgg atccattcgg ccttggattt       420
     aatcctttgg gccacttttc gttccaatct tgggcagagg atctgtccga gtacacatat       480
     tttggccaaa actatctcaa agacttaatt cccgcactac aaacctgtca tattggaact       540
     gattcggacc ttgaccctat acacaatgcg ggcaagtatc agccttatgt cgaatttaat       600
     gagacaattt tcaccttgcc ccatttgcga aaactctgca tcacaggtgt tacgtttcgg       660
     gactttggat tgaaagacga gctcattgaa catcgtacca cgaatctaaa agagttgctg       720
     cttctcaact gtggaatctc aactgagaat ctcgaactca tcattcgatt cccgcgtgcc       780
     ttagaacggc ttaccattag agttcctgtt tctttactat ctgaatacga ggaagaagat       840
     tacctgtcat tctccgggga attgagtgct cggcatgctg aatccttgga gtacttggat       900
     ttagacattt acggaggcct cgatgtcggc tttgggctcg attactttga tgttctcaag       960
     gaaatcgtaa tcacccctca ttcagtgatt aaggatcacg atggagagac agtcttgaca      1020
     agtagtctcc agagacttac aatccgatac gaggaaggca ctggtctact actagacgac      1080
     atcttcaatc aagtcgagac cgcaaaactc cccaacctgc gctccgtgat atgccaaata      1140
     cccgacaatc tctgcgaagg tacaaccagc tcggcggtac gcgtcgaagc cgaggctttc      1200
     aaatccctat tcaaagatct cggggtggag ctatcaacag aactcgttcc atatcctctg      1260
     accatgccga aatatgatgt ttgtccgtgt gaaaacttga ccttctatca tcaatttccc      1320
     ttccatcccc gccccaagcc tcgcccgcaa aacgtgccgg caagctacag caaccctatg      1380
     ccgatgcccg tcgttcatga ctcggaccca tatgacggtg actatcctta cctatatgac      1440
     atgagcccgc cttctcctcc ccgaatgccc acttctatgc ccacctttat ggactacgat      1500
     gactatcttg actggatgta tggcggttga                                       1530
//

If you have problems or comments...

PBIL Back to PBIL home page