(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE430

PENCW_10.PE430       Location/Qualifiers
FT   CDS_pept        1026552..1027613
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000162167" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15950903"
FT                   /orf_name="Pc13g04300"
FT                   /product="Pc13g04300 protein"
FT                   /protein_id="CAP91499.1"
FT                   /db_xref="UniParc:UPI0001830AD3"
FT                   /db_xref="UniProtKB/TrEMBL:B6H285"
FT                   /transl_table=1
FT                   /translation="MAATSTPGNNEPHRILLVSVPRTASNLLLKVLNIPNQPNVLSSPK
FT                   GGYFFYDAFMAAGIEGLVEKPLDQWTAEEKSETKAVVQKCFDRLEEYSARARAENKIMF
FT                   TKEHAFWLVNPCFFTNNEGITPEDHSQFQVSMPERYGSSATFSAKNKTIMPDEYLRTWR
FT                   IAFIIRHPALAWPSMYRAMQKLSKAGFIDDDGMRGASFTNMSMEWTRTLFDWCREQPDE
FT                   SVTPLVIDANDVIHNPGAVVKFCEKAGLDTSFMQFEWNGAEKKSESWAAETANADTPEE
FT                   VAFHKTAASIMLSTLEESTGVVKDKAPASVDIDAEVAKWRLEFGDEVAELIEKATRDSM
FT                   PDYEYLKANRVTA"
     atggctgcca cttccacccc tggaaataat gaaccccacc gaatcctcct cgtcagtgta        60
     ccgcgcactg cctcgaatct tctcctgaag gtcctcaaca tccccaacca accaaatgtc       120
     ctcagcagcc caaagggcgg ctacttcttc tacgatgcct tcatggcagc cggcattgag       180
     ggtctcgtcg aaaaaccgct agaccaatgg actgccgagg agaagagcga aaccaaagcc       240
     gtcgtgcaga agtgcttcga cagactagag gagtactccg cccgagcccg cgccgagaac       300
     aagatcatgt tcaccaaaga acacgctttc tggttggtta acccgtgctt cttcacgaac       360
     aatgaaggca tcacacctga agatcacagc cagttccagg tatctatgcc tgaacgctac       420
     gggtcctcgg cgaccttctc cgccaagaac aaaaccatca tgccggacga gtatctgcgc       480
     acctggcgga tcgctttcat catccgtcac ccggcactgg cctggccgtc catgtaccgc       540
     gctatgcaga agttgtccaa ggctgggttc attgatgacg acggcatgag gggtgcgtcg       600
     tttacaaaca tgagcatgga gtggacgcgg acgctgtttg actggtgtcg tgagcagccg       660
     gatgagtctg tcacgccttt ggttatcgat gctaatgatg tcatccataa ccccggtgct       720
     gtggttaagt tctgtgagaa ggctggtctt gacacttctt tcatgcagtt tgagtggaat       780
     ggtgctgaga agaagtctga gagctgggcg gctgagactg cgaacgcgga tacgcctgag       840
     gaggtggcgt tccataagac tgctgcttct atcatgttat cgactttgga ggagtcgact       900
     ggtgttgtta aggataaggc tccggcgtcg gttgatatcg atgcggaggt tgctaagtgg       960
     cgtctcgagt ttggggatga ggttgccgag ttgattgaga aggctacgag agattctatg      1020
     ccggattatg agtatctgaa ggctaatagg gttactgcct aa                         1062
//

If you have problems or comments...

PBIL Back to PBIL home page