(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE433

PENCW_10.PE433       Location/Qualifiers
FT   CDS_pept        join(<1033861..1033958,1034015..1034218,1034276..1034730,
FT                   1034851..1035502,1035567..1035804)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000213984" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20672473"
FT                   /orf_name="Pc13g04330"
FT                   /product="Pc13g04330 protein"
FT                   /function="RNA binding"
FT                   /function="pseudouridine synthase activity"
FT                   /biological_process="pseudouridine synthesis"
FT                   /protein_id="CAP91502.1"
FT                   /db_xref="GO:0001522"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0009982"
FT                   /db_xref="InterPro:IPR001406"
FT                   /db_xref="InterPro:IPR020094"
FT                   /db_xref="InterPro:IPR020095"
FT                   /db_xref="InterPro:IPR020097"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniParc:UPI0001830AD6"
FT                   /db_xref="UniProtKB/TrEMBL:B6H289"
FT                   /transl_table=1
FT                   /translation="RDLPTDTMADNKGTGGGGGGRRKNRDMGRAEWSRQAIDKRQRHEE
FT                   KAEVKRRKIENGEEVKLPIYATQFSKEEIDSEERRPKKKVALLMGYSGTGYSGMQLNEQ
FT                   QRTIEGDLFTALVNVGAVSKANAADPKKSSFVRCARTDKGVHAAGNVVSLKMIVEDEDI
FT                   IQKINAELSPQIRVWGYEVTSKSFSCYQMCDSRVYEYLMPSHCLVPPHPSTYLGKKIVE
FT                   LADKAGELDAVKTRQEEVASYWEEVDEKYITEEPAQQETSEQPVAEQSADAEAQKPFVM
FT                   DPRQKAINDAIKSIKAAYLTAKRAYRAPASRIARLQECLNRYEGTKNFHNYTIQKTHKD
FT                   PSAKRHIKSFKVNTTPIIINGTEWLSLKVHGQSFMMHQIRKMVAMATMVVRSGCHPDRI
FT                   TETYGPERIAIPKAPGLGLLLERPIFDAYNNKAQGLDRQPINFQKFEAEMNEFKQREIY
FT                   DRIFREEEESAGFGSFFNHIDHFPAGYFLYVTSGGIPAAKLATAPTPAGPGSPKAGNKT
FT                   RGAPRQQDALAAVEVESEDEGDAPAGGEQEG"
     agagatcttc caacggatac aatggccgac aacaaaggaa caggaggcgg aggtggtgga        60
     aggcgtaaga accgcgatat ggggcgagcg gaatggagtc gccaagccat agataagcgg       120
     cagcgtcatg aagagaaggc tgaagtcaag cgtcgcaaga tcgagaatgg cgaagaggtc       180
     aaattgccga tctacgcgac ccaattctcc aaagaggaga ttgacagcga agagcgccgc       240
     cccaaaaaga aggttgcgct tctgatgggg tactcgggga ctggatactc tgggatgcag       300
     ctaaacgagc agcaacgcac cattgaaggt gatctattca cggccctcgt caacgtcggc       360
     gcggtttcca aagcgaatgc ggcggatccc aagaaatctt ctttcgtccg ctgtgcccgc       420
     acagacaagg gtgtccacgc agcgggcaat gttgtatcgc taaagatgat cgtcgaagat       480
     gaggatatca tccagaaaat caacgccgag ctcagccccc agatccgtgt ctggggctac       540
     gaagtgacca gcaaaagttt cagctgctac cagatgtgcg attcccgagt atacgaatat       600
     ttgatgccaa gtcactgtct cgtaccacct catccaagca cctatcttgg aaagaagatc       660
     gtcgagcttg ccgacaaggc aggcgaattg gatgccgtca agactcgaca ggaagaggtc       720
     gcaagctatt gggaagaagt cgatgagaag tacatcaccg aggaacccgc ccagcaggag       780
     actagcgaac agcccgtggc cgaacaatca gccgacgcag aggctcaaaa gccgttcgtc       840
     atggaccccc gccaaaaggc catcaacgac gccatcaagt ccatcaaagc agcataccta       900
     accgcgaaac gagcctaccg cgcgcccgct tcacgtatcg cccgcctgca agaatgtctt       960
     aatcgctacg aaggcacgaa gaacttccac aactacacga tccagaaaac gcacaaggat      1020
     ccctcggcga aacgacacat caagtcattc aaggtgaaca ccacgccgat tatcatcaat      1080
     ggcacggaat ggctcagcct gaaggtccac ggacagagtt tcatgatgca ccagatccgc      1140
     aagatggtcg ccatggctac gatggttgtc cgctcgggct gccatccaga ccgcatcact      1200
     gagacctatg gccctgagcg cattgctatt cccaaagcgc ctggtttggg cctcttgctt      1260
     gagcggccta ttttcgacgc ttacaataac aaggcacagg gtcttgatcg tcagccgatc      1320
     aatttccaga aatttgaagc ggagatgaat gagttcaagc agcgggagat ctacgatcgg      1380
     attttccggg aggaggagga aagtgctggt tttggttctt tcttcaacca tatcgatcac      1440
     ttccccgcgg gttacttcct ctatgtgact tccggtggca ttccagcagc taaactcgca      1500
     actgcaccta cccctgctgg tcccggcagc cccaaagctg gtaacaaaac ccgcggtgct      1560
     ccgcgtcagc aggatgcact tgctgctgtt gaggttgaat cagaagatga gggcgatgct      1620
     ccagctggcg gagagcaaga gggttaa                                          1647
//

If you have problems or comments...

PBIL Back to PBIL home page