(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE435

PENCW_10.PE435       Location/Qualifiers
FT   CDS_pept        join(complement(1045689..1045849),
FT                   complement(1045201..1045597),complement(1045069..1045146))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000049435" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15950904"
FT                   /orf_name="Pc13g04350"
FT                   /product="Pc13g04350 protein"
FT                   /function="transferase activity"
FT                   /protein_id="CAP91504.1"
FT                   /db_xref="GO:0016740"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="UniParc:UPI0001830AD7"
FT                   /db_xref="UniProtKB/TrEMBL:B6H290"
FT                   /transl_table=1
FT                   /translation="MSHPTEKEKMLRGELYRAFTPELIAARSRCKWACNRFNKSDEVPR
FT                   RRLVEMWRDITDDKTPLPPKLDDPAADEALFAKEPWVESPVHIDYGFNVKLGEGVFVNF
FT                   NCVFIDTCPITVGARTLFGPNVSLFSGTHPLDPALRNGTEGPETGNPIVIGEDCWLGGN
FT                   VTVLPGVTIGKGATIGAGSVVTKDVPAFHVAAGNPAKIIRRIETTMKE"
     atgtcgcatc ctactgagaa agagaagatg cttcgcgggg agctctatcg agcgttcacg        60
     ccggaattga tcgctgctcg ttcgcgctgc aagtgggcct gtaatcggtt caataagtcg       120
     gacgaggtgc cacgtcggcg tctcgttgaa atgtggagag acatcactga cgacaagacc       180
     cctctaccac cgaagctgga tgatcccgca gccgatgaag ctctctttgc gaaggaaccc       240
     tgggttgaat ctcccgtcca tatagactat gggtttaacg tcaagcttgg agagggtgtc       300
     tttgtcaact tcaactgtgt cttcatcgac acgtgtccca tcacggtcgg ggctcgtact       360
     ttgttcggcc ctaatgtcag cttgttctcc gggacccatc cccttgatcc tgccctacgc       420
     aatggcaccg aaggtcctga gactggcaac ccaattgtta tcggggagga ctgctggctt       480
     ggcgggaatg tgactgtact tcctggcgtc actattggca aaggtgcaac tattggagct       540
     ggcagtgtgg tcaccaagga tgtgcctgct tttcatgtgg cagctgggaa cccagctaag       600
     atcattcgtc ggattgaaac gacaatgaaa gagtga                                 636
//

If you have problems or comments...

PBIL Back to PBIL home page