(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE436

PENCW_10.PE436       Location/Qualifiers
FT   CDS_pept        join(1046176..1046983,1047045..1047130)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000213961" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15950905"
FT                   /orf_name="Pc13g04360"
FT                   /product="Pc13g04360 protein"
FT                   /function="protein C-terminal S-isoprenylcysteine carboxyl
FT                   O-methyltransferase activity"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP91505.1"
FT                   /db_xref="GO:0004671"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="InterPro:IPR007269"
FT                   /db_xref="UniParc:UPI0001830AD8"
FT                   /db_xref="UniProtKB/TrEMBL:B6H291"
FT                   /transl_table=1
FT                   /translation="MFSNPSATTSGAEPNKAPNFTHISRPLVHDRTNSNTSSSSSDVST
FT                   DAPNPDTSIYPDGKMSLAGISLRAMLLGTSLGLSASMALYLSTVYYTPLWRVPFFIASL
FT                   SLFHFLEFYVTAQHNTRYATVSAFLLSSNGWAYNVAHGSAIVECIVSHVFWPGQTAAGR
FT                   MITVTEPFFGSSVSLLLIVGFVLLLIGQVIRTVAMAQAASNFNHHVQSQHQEGHVLVNT
FT                   GLYRYLRHPSYFGFFWWGLGTQLVLGNMVCFVGYALVLWQFFSSRIKREEAYLISFFGD
FT                   EYVQYRKVTSVGIPGI"
     atgttctcca acccctccgc aacaacttcc ggcgcggagc caaacaaagc cccgaacttc        60
     acgcacattt ccaggcctct agtccacgat cgcaccaaca gcaacacatc ctcctcctct       120
     tccgatgtct cgaccgacgc gcccaatccc gatacctcga tctacccgga cggcaagatg       180
     tcgctggcgg ggatctcgct tcgcgccatg ctcctcggaa ccagtctcgg gctatcagca       240
     agcatggcgt tatacttaag caccgtgtat tacactccgc tgtggcgcgt acccttcttc       300
     atcgcctcgc tgagcctctt ccacttctta gagttctacg tgacggcgca gcacaatacg       360
     cggtatgcga ctgtctccgc tttcctgcta tcatcgaacg gatgggcata taatgttgcg       420
     cacgggtctg ccattgtgga gtgcatcgtg tcgcatgtct tctggcccgg acagactgct       480
     gctgggcgga tgatcaccgt gacggaaccg tttttcggaa gctcggtgtc gttgctgctt       540
     atcgtaggct ttgtgcttct gttgatcgga caggttattc ggactgttgc tatggcgcag       600
     gctgctagta acttcaatca ccatgtgcag agtcagcatc aggaaggtca tgttttggtt       660
     aatactggtc tttatcggta tctccggcat ccgagctact ttggattttt ctggtggggt       720
     ctaggaacac aactggtgct tgggaatatg gtttgctttg tcggatatgc cctagtcttg       780
     tggcagttct tctcgagccg gatcaagcgc gaagaagctt acttgatctc cttctttggg       840
     gacgagtatg ttcagtacag aaaagtcacc tcggttggta tcccgggaat ttag             894
//

If you have problems or comments...

PBIL Back to PBIL home page