(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE438

PENCW_10.PE438       Location/Qualifiers
FT   CDS_pept        join(1049856..1050145,1050214..1050334)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000213929" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15950906"
FT                   /orf_name="Pc13g04380"
FT                   /product="Pc13g04380 protein"
FT                   /protein_id="CAP91507.1"
FT                   /db_xref="InterPro:IPR019334"
FT                   /db_xref="UniParc:UPI0001830AD9"
FT                   /db_xref="UniProtKB/TrEMBL:B6H293"
FT                   /transl_table=1
FT                   /translation="MANNRIPINYEVPSFPSLYDPLPAHHQQAYYLYYTKDIWRFTFFW
FT                   TLIFYAATHLTVSGCAALTHFRNWNVIWIVPLVYIFIAALEALIAGSIIGVVLGAVYEA
FT                   GNFRMSTWLPMIWGGVNVMVLIVTSFPMQGGL"
     atggccaaca accgcatccc aattaactac gaagtacctt ctttcccgtc attatacgat        60
     cccctgccgg cgcatcatca gcaagcatac tatctctact acacgaagga catctggcgc       120
     ttcacctttt tctggacgtt gatattctac gccgcaacac atctcactgt ttctgggtgc       180
     gcagcgttga ctcattttcg taactggaat gtgatatgga ttgtgccttt ggtgtacatt       240
     ttcatcgcag cgctggaggc tcttatagcc gggagtatca tcggagttgt cctcggtgca       300
     gtgtatgaag caggcaattt caggatgtca acttggctac cgatgatatg gggtggagtc       360
     aatgtcatgg ttctcattgt caccagcttc cccatgcagg gtggtctttg a                411
//

If you have problems or comments...

PBIL Back to PBIL home page