(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE439

PENCW_10.PE439       Location/Qualifiers
FT   CDS_pept        join(complement(1052513..1052597),
FT                   complement(1052315..1052430),complement(1052058..1052258),
FT                   complement(1050592..1051995))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000213918" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19825168"
FT                   /orf_name="Pc13g04390"
FT                   /product="Pc13g04390 protein"
FT                   /protein_id="CAP91508.1"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniParc:UPI0001830ADA"
FT                   /db_xref="UniProtKB/TrEMBL:B6H294"
FT                   /transl_table=1
FT                   /translation="MAYYEDNAGDGPGRFGKNFDGPVGPRRPRLVTDYGSSMVQWMRTQ
FT                   QPRYKGGHRLETERPSASFAVDVLPPMARPHSAVDTIPVRHLHQSIGKSKKPIVVVRWT
FT                   PEGRRLLTGGHTGEFMLWNGTAFNFETVMDAHYDQIQAGVTSLAWAHSQDWLVSGGQRG
FT                   DIKYWRPNFNNVETIDDAHHDAVRDLAWAPSDTKFLSASDDTTLKIFDFATRTADETLT
FT                   GHNWDVKSCDWHPTKGLIVSGSKDHQVKFWDPRTGRCLTTLHSHKNTVTSTRFSRVNSN
FT                   LLATSSRDQTARVFDLRMMRDICILRGHDKPVSSLTWHPIHSNLISTGAEDGSLYHYLL
FT                   DEPHLPAGQIPTVAPYDSPDPANTPPQVIYPAHRIQYAHGATIWSLDWHPLGHILASGS
FT                   KDNFTRFWSRSRPGETSYMKDRFHIGEEAAEAQGTWNRGFGRKQMRDDEEQEMQDEADS
FT                   LVDQRRPGGPALPGIQSAPPAGPQPDVVGLLPGIGSAQPRQPGMDGGAMSGMDPGRLAA
FT                   LMSSRPPSQSSTPTPAMHGFPMPQGMTGTPPMNMDLAQLQKQLQGFPMPQNLNLQALAN
FT                   NPGFPGGFGGLPGLQGGGTPDGNRR"
     atggcctact acgaggacaa tgcaggtgac ggtccagggc ggtttggcaa gaatttcgat        60
     ggtccagtcg gacctcgcag accacgtctt gtcacggatt atggctcttc aatggtacaa       120
     tggatgagaa cacaacaacc gagatacaaa ggagggcatc gattggagac agaaaggccg       180
     agtgccagct ttgctgtcga tgttcttccc ccgatggcgc ggccccattc tgctgtcgat       240
     acaatccccg tccgacacct tcaccagtca atcggaaaat caaagaaacc catcgtcgtg       300
     gtgcgatgga ctcccgaggg aaggcggctg ttgaccggcg gtcatacggg agagtttatg       360
     ctttggaatg gaacggcgtt caatttcgag acggttatgg atgcacacta cgatcaaata       420
     caggctggtg tcacctcctt ggcatgggcc catagccagg actggctggt ctctggcgga       480
     cagagaggcg atatcaaata ctggcgacca aacttcaaca acgtcgagac gatcgatgac       540
     gcgcaccacg acgcggtccg cgatctggcc tgggcaccca gtgatactaa atttctttca       600
     gcgtccgatg acacaaccct caaaattttc gactttgcaa cccgaacggc cgacgaaaca       660
     ctgaccggac acaactggga tgtcaagtct tgcgactggc acccaaccaa gggtctgatc       720
     gtttctggat cgaaggacca ccaggttaag ttctgggatc cgcgcactgg tcgctgcttg       780
     accaccctcc acagtcacaa aaacaccgtc acatcgacgc ggttctcgcg tgtgaacagc       840
     aacctccttg ctacttcgtc gcgagaccag accgcgagag tatttgattt gcggatgatg       900
     cgcgatattt gcattctgcg aggccacgac aagccggttt cttctctgac atggcacccg       960
     attcacagta acctcatctc gactggagcc gaggatggtt ctctatatca ttatctactt      1020
     gatgagcctc acctgccggc cggccagatt cctaccgtgg cgccgtatga cagcccggac      1080
     ccagccaata ctccgccgca ggtgatctat ccggcacatc ggatacagta cgcgcacggt      1140
     gctactattt ggtcactaga ctggcatcca ctaggccata tcttggcttc tggatctaag      1200
     gataacttca ctcgattctg gtcgcgcagt cggcctggcg agactagcta tatgaaagac      1260
     agattccaca tcggcgaaga ggccgcagaa gcccagggaa catggaaccg cgggtttggc      1320
     cggaaacaaa tgcgcgatga cgaggagcaa gaaatgcagg acgaagctga cagcctggtc      1380
     gaccaacgac gaccaggcgg ccctgctctg ccaggtattc aaagtgcgcc gccggccggg      1440
     cctcagcctg acgttgtagg tttgctgcct ggtattggca gtgctcagcc tcgacagcca      1500
     ggaatggatg gaggtgcgat gagtgggatg gatccgggcc gtttggctgc actcatgtcc      1560
     tctcgccctc catcgcagtc aagtaccccg acgcctgcaa tgcatgggtt ccccatgccg      1620
     cagggtatga ccggaacacc gccgatgaac atggacctag cacagttgca gaagcaactc      1680
     cagggtttcc ccatgccaca gaatctcaac ctccaagctt tggcgaacaa ccctggcttc      1740
     cctggcggat ttggtggcct gcctggtttg caaggcggtg gtacgcctga tggcaatcgg      1800
     agatag                                                                 1806
//

If you have problems or comments...

PBIL Back to PBIL home page