(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE440

PENCW_10.PE440       Location/Qualifiers
FT   CDS_pept        join(1053048..1053285,1053335..1053379,1053480..1054430,
FT                   1054478..1054662,1054761..1054784)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000213917" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15950907"
FT                   /orf_name="Pc13g04400"
FT                   /product="Pc13g04400 protein"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP91509.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="InterPro:IPR004299"
FT                   /db_xref="UniParc:UPI0001830ADB"
FT                   /db_xref="UniProtKB/TrEMBL:B6H295"
FT                   /transl_table=1
FT                   /translation="MTTRTGAIASAREESQLNSRKGVQNETEVALPSTSTAKKRSKYRH
FT                   VAAYHSESRPSSLSREADVLPNFLGFRNLMVLVLVAMNLRLVIENFMKVDVVLGSILFA
FT                   SVPCHLLVAYIIELSAATAAKQTVGRQKKTEKEKEHDQKVFQSTWPYTAFLHTLNATLC
FT                   LAVTSFVVYFYIHHPGIGTICQLHAIIVWLKNCSYAFTNRDLRLALLNPSADPGLPKIY
FT                   SSCPYPRNITINNLAYFWLAPTLVYQPVYPRTASIRWSFVAKRLAEFVGLAVFIWLLSA
FT                   QYAAPVLRNSIDKIAVMDIASILERVMKLSTISLIIWLAGFFALFQALLNALAEVMRFG
FT                   DREFYTDWWNSSSLGMYWRSWNRPVYLFMKRHVYSPLVGRGWSPLAASGMVFTLSAILH
FT                   EMLVGIPTHNFIGVAFFGMMFQLPLISLTAPLDNMRGPEGRVIGNCIFWVSFCLVGQPL
FT                   GALLYFFAWQAKYGSFSLGMYS"
     atgactactc gcactggagc aattgcgagc gctcgcgagg aatcgcagct caattcgagg        60
     aaaggggtcc agaatgaaac cgaggtcgct ctaccatcaa cgtcaactgc aaagaaacga       120
     agtaaatatc gccatgtagc tgcatatcac tcggaatctc gtccttccag cctcagtcga       180
     gaggccgatg tcctgcccaa cttcctggga tttcgaaatc tcatggtgtt ggtacttgtg       240
     gcaatgaatc tgcgattggt tattgagaac ttcatgaaag tggacgttgt gctggggtct       300
     atattgtttg cctcggttcc atgtcatctg ctagtggcat acatcatcga actttcagcc       360
     gctacagcag ccaagcagac agtgggccgt cagaagaaga cagagaaaga gaaagagcac       420
     gaccagaagg tcttccagtc gacatggccg tacactgctt tcctacacac gctcaacgcc       480
     acgctgtgcc tcgcagtaac cagcttcgtg gtgtatttct acatccacca cccgggtatt       540
     gggacaatat gccagctgca cgctatcatc gtgtggctga aaaactgctc ttacgccttc       600
     acaaaccgag atctccgtct cgcgttactc aatccctccg cagacccggg cttgcccaaa       660
     atctactcct catgtcccta cccgagaaat attactatta ataacctggc gtatttctgg       720
     ctggcgccga cgctggtgta tcagcctgtt tacccgcgca cagcatccat ccggtggtca       780
     tttgttgcaa agcgccttgc agagttcgtg ggtttggcag tgttcatttg gcttctgtct       840
     gctcagtatg ccgcaccggt gttacgcaac tcgattgata agatcgcagt aatggacatt       900
     gcctcgattt tggagcgggt tatgaaactg tccactatct cgctgattat ctggcttgct       960
     ggcttctttg cattgttcca agcgcttttg aatgctctgg ccgaggtcat gcggttcgga      1020
     gaccgcgagt tctacactga ctggtggaac agctccagtc tgggtatgta ttggaggtct      1080
     tggaatcggc ctgtctatct gttcatgaag agacatgttt actctccgct ggtgggtcgg      1140
     ggatggagtc ctctggctgc gagtggaatg gtgttcacgc tctctgccat ccttcacgaa      1200
     atgctggtgg ggattcctac acataatttc atcggcgtcg cgttctttgg aatgatgttc      1260
     cagctgccgt taattagcct caccgcaccg ttagataata tgcgtgggcc tgaaggtagg      1320
     gttattggaa actgcatctt ttgggtcagc ttctgtctag tcggacaacc gcttggagcg      1380
     ctcctatact tcttcgcttg gcaggccaag tacgggagtt tctctttggg catgtattcg      1440
     tga                                                                    1443
//

If you have problems or comments...

PBIL Back to PBIL home page