(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE441

PENCW_10.PE441       Location/Qualifiers
FT   CDS_pept        join(1055142..1055173,1055236..1055371,1055473..1055760)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000116372" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15950908"
FT                   /orf_name="Pc13g04410"
FT                   /product="Pc13g04410 protein"
FT                   /protein_id="CAP91510.1"
FT                   /db_xref="InterPro:IPR001129"
FT                   /db_xref="UniParc:UPI0001830B82"
FT                   /db_xref="UniProtKB/TrEMBL:B6H287"
FT                   /transl_table=1
FT                   /translation="MVAFIVPGNYGAVIGVALGAIPVLGFVHGNITGSLRKQAKVPYPH
FT                   SYASMELCRENAKAEQFNCAQRAHTNFLENASQTMLFTLVAGLKYPEWAAGLGALWVFF
FT                   RALFLYGYVYSGKPQGKGRMIGGFFWLVQGALWGLSVYGVGRPLLSF"
     atggtcgcat tcattgttcc cggcaactac ggtgccgtca tcggcgtcgc tctcggcgcc        60
     atccccgtct tgggctttgt gcacggcaat atcactggaa gcctgcgcaa gcaggccaaa       120
     gtgccctacc cccacagcta tgcctccatg gagctatgca gggaaaacgc caaagccgag       180
     cagttcaact gcgcccagcg cgcccacacc aacttccttg agaacgcctc gcagacaatg       240
     ctcttcaccc tggtcgccgg tcttaagtac cctgagtggg ctgctggcct gggagctctc       300
     tgggttttct tccgcgctct gttcctttat ggctatgtat actctggcaa gccgcagggt       360
     aagggccgca tgatcggcgg gttcttctgg cttgtgcaag gtgctctgtg gggattgagt       420
     gtctacggag ttggacggcc cctgctttct ttctaa                                 456
//

If you have problems or comments...

PBIL Back to PBIL home page