(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE443

PENCW_10.PE443       Location/Qualifiers
FT   CDS_pept        join(1058031..1058283,1058406..1058501,1058577..1058782,
FT                   1058872..1059291,1059343..1059691,1059748..1059932)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000171758" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15950909"
FT                   /orf_name="Pc13g04430"
FT                   /product="Pc13g04430 protein"
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="CAP91512.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI0001830B84"
FT                   /db_xref="UniProtKB/TrEMBL:B6H2A5"
FT                   /transl_table=1
FT                   /translation="MASEEKAIGISSGVDTGFDVGKTKHVDPTMEKHAHDADEALKALG
FT                   DLQGETIELDEATNRRLLSVIDWHMMPIMCFVYGMNYLDKTTLSYASVMGIKKDLNLEG
FT                   DQYQWLGSLFYFGYLAWEYPTNRLLQRLPLGKYSAACILIWGLILSCFAAVSNYQGAIA
FT                   IRFMLGVFEAAVTPGFALLTSQWYTKQEQGSRVNIWFSFNGVGQIFGGVVAYGIAVGTE
FT                   KHGSSIEPWKIVFLVTGLLTICLGLVFLWIVPDNQLNARWLNEEDRILAVARVRVNQQG
FT                   IGNKHFKLYQVKEALLDPMTWAFFFYALIADIPNGGITNFFNQLITSFGYNEKESLILG
FT                   VPGGAVEIVALLLNGYVGHIAGQRILASLGGLVAAIVGMLLIVALPLSNNVGRLIGYYL
FT                   TQASPTPFVALLSLISSNVAGYTKKTTVAALYLIGYCAGNIIGPQTFRPKDAPRYVPAE
FT                   VTIIVCWGVCLFLLVGVWMWYRRENQKKLLFTARPEYVRLENQE"
     atggcttcgg aggagaaggc catcggtatt tcctctggcg tggacactgg tttcgatgtg        60
     ggcaagacaa aacatgttga ccccacgatg gagaagcatg cacacgacgc cgatgaggct       120
     ctgaaggccc ttggcgatct tcagggtgaa actatcgagc tggatgaggc tacgaatcgc       180
     cgtttgctaa gtgttattga ttggcatatg atgcctatta tgtgctttgt ctatggcatg       240
     aattatttgg ataaaaccac cctctcctat gccagtgtta tgggtattaa gaaggatctg       300
     aatcttgagg gagatcagta tcagtggtta ggaagtttgt tctactttgg ttatctcgcc       360
     tgggaatacc caaccaaccg cctcctccag cgcctcccac taggaaaata ctctgcagcc       420
     tgtatcttaa tctggggatt gattctcagc tgttttgccg ctgtcagcaa ctaccaaggt       480
     gctatcgcta tccgctttat gctcggtgta ttcgaagccg ccgtgacgcc gggcttcgca       540
     ctcttaactt cccagtggta cacaaaacaa gaacaaggca gccgcgtcaa catctggttc       600
     agcttcaacg gcgtgggcca gatcttcggc ggagtagtcg cgtacgggat cgccgtcggc       660
     accgagaaac acgggtcctc catcgagcca tggaagattg tattcctcgt cacgggtctc       720
     ctcaccatct gcctgggcct ggtattcctc tggattgtac cagacaacca actcaacgca       780
     cggtggttga atgaagaaga tcgcatcttg gctgttgcgc gtgtgcgggt caaccagcag       840
     ggcattggaa ataagcattt caagctatat caggtcaagg aggcgctttt ggatccgatg       900
     acctgggctt tcttctttta tgctttgatt gctgatattc cgaatggggg gattaccaat       960
     ttcttcaatc agctgattac gagcttcggc tacaatgaga aagagagtct gattctgggt      1020
     gtccctggtg gcgcagtgga aatcgttgca ttgctactca acggctatgt cggacatatc      1080
     gctggacagc gtatcctcgc cagtttgggt ggcctagtcg ctgcgatcgt ggggatgttg      1140
     ctgattgttg ccctgccctt atcaaacaat gttggtcgtt tgattggcta ctacctcaca      1200
     caagccagcc cgacaccttt tgtggcattg ctgtcgctga tttcatccaa tgttgcggga      1260
     tatactaaga agacgactgt ggcggcttta tatttgattg gatattgtgc tggaaatatt      1320
     atcggcccac aaaccttccg ccccaaggac gccccccgct atgtccccgc agaggtgaca      1380
     atcatcgtct gctggggtgt gtgtctgttt ctgctggttg gggtgtggat gtggtatcgt      1440
     cgtgagaacc agaagaagct ccttttcact gcccgaccag aatatgtgag actagagaat      1500
     caagagtga                                                              1509
//

If you have problems or comments...

PBIL Back to PBIL home page