(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE445

PENCW_10.PE445       Location/Qualifiers
FT   CDS_pept        join(complement(1063598..1063629),
FT                   complement(1063123..1063483),complement(1062874..1063047))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000213883" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15950910"
FT                   /orf_name="Pc13g04450"
FT                   /product="Pc13g04450 protein"
FT                   /function="rRNA binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAP91514.1"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0019843"
FT                   /db_xref="InterPro:IPR001912"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR022801"
FT                   /db_xref="UniParc:UPI0001830B86"
FT                   /db_xref="UniProtKB/TrEMBL:B6H297"
FT                   /transl_table=1
FT                   /translation="MVRELKHHEKKLLRKVDFHNYKSDGNHREHEIRQRYLLQDPMDYR
FT                   KYNALCGSLRQLAHKLSQLDPDADPLRKKLESELLEKLWRMGILKQSREQGAGLSKVER
FT                   EVTVSALCRRRLAVFMVRSGMVETIKAATTFIEQGHVRVGTEVVNDPAFLVTRNMEDFV
FT                   TWVDSSKIKRNILRYREKLDDFDLL"
     atggttcgtg aactcaagca ccacgagaag aaacttctcc ggaaggtcga cttccacaac        60
     tacaagtccg acggcaacca ccgcgaacat gaaatccgcc aacgatacct cctccaagac       120
     ccaatggact accgcaaata taacgcgctc tgcggttctc tgcgccagct cgcccacaag       180
     ctctcccaac tggacccgga tgccgacccg ctgcgcaaga agcttgaatc cgagctgctg       240
     gagaagctgt ggcgcatggg aatcctgaag cagtcccgcg agcagggcgc cggtctatcc       300
     aaggtcgagc gcgaggttac agtttctgcg ttatgccgtc gtcggttggc tgtcttcatg       360
     gtgcgctctg gcatggttga gactattaag gctgctacca ctttcattga gcagggtcat       420
     gtccgtgttg gtaccgaggt cgtgaatgat cctgctttct tggttacccg taacatggag       480
     gactttgtta cctgggttga ttccagtaag atcaagcgca acatcttgcg gtaccgtgag       540
     aagttggatg actttgatct tctgtga                                           567
//

If you have problems or comments...

PBIL Back to PBIL home page