(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE446

PENCW_10.PE446       Location/Qualifiers
FT   CDS_pept        join(1063858..1064844,1064904..1065434)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076583" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18978332"
FT                   /orf_name="Pc13g04460"
FT                   /product="Pc13g04460 protein"
FT                   /protein_id="CAP91515.1"
FT                   /db_xref="UniParc:UPI0001830B87"
FT                   /db_xref="UniProtKB/TrEMBL:B6H298"
FT                   /transl_table=1
FT                   /translation="MENQADTPSKMSGRPRVDLEPYKAEIIGLYEKKMKSDDICKHMKR
FT                   QHDIQISARTLTKRLQLWGVKKKMENNSSNEALHARIKNLFFDVGLTDQEIVTVLHDEG
FT                   YDVSARTLRRLRHQLGIRLRLDSPTQQQAQVQEILDALTEEMDKGTIEGYGKELLHNHF
FT                   RSKGYVFARDRLYSVYRMLRPDTVERRTRDMHRPPPPPKILAGPNLTWHVNGYSKLANF
FT                   GFRIHAELDAYSRYVLWIHVGVDAHASVGVLKNHLDTVASKNRQPRTLRSDLESEVPLL
FT                   ADAHFALRRVTEPDVQREQCCAPGRATDTHRIESWWAQLAKSVVTLYHNYFRELHNQGL
FT                   FSSTVIPEQVALLAIYMPTLRSHIKSYVQTWNMHNIRKQADHPERAPGKPYMNYHHPPK
FT                   GVENFGLPADVPMLQSMQQNHADYDTEQYLPPDTLHWCEMQLQQLGFDPHKPPARLPGD
FT                   LQPFRSVYLALRERAWHHERSGAEPKLAVCAFPGQGLRGYFPSGHAR"
     atggagaatc aagctgacac gccaagtaaa atgtcaggtc gccctcgggt ggacctcgag        60
     ccgtacaaag cagaaatcat tggcctctac gaaaagaaaa tgaagagtga cgacatttgc       120
     aagcacatga agaggcagca tgatattcag atctcggcgc gtactctgac aaaacgcctg       180
     cagctatggg gcgtcaagaa aaagatggag aacaattcct ctaacgaagc gctgcacgcc       240
     agaatcaaaa acctcttctt cgacgtgggg ctgaccgacc aagagatcgt caccgttcta       300
     cacgacgagg gctacgatgt ctccgcccgt acgctacgca gactccgtca ccagcttggt       360
     atccgcctcc gccttgattc gcctacgcaa caacaagcac aggtccagga gatcctcgac       420
     gctctgaccg aggaaatgga caagggaacc attgagggat atggaaagga actactgcac       480
     aaccacttcc gaagcaaggg gtacgtcttt gcccgagatc gtctctacag tgtctatcgc       540
     atgctgcgcc cggatacagt tgaacgccgc acgagagata tgcatcggcc ccctcccccg       600
     ccgaagattc tagccggacc taatttgacc tggcatgtga acgggtactc aaagctagcc       660
     aacttcgggt tccgcattca tgccgagctc gatgcgtatt ctcgatatgt cctgtggatc       720
     catgttggtg tggacgcgca tgcatctgtg ggcgttctca aaaaccatct cgacactgtt       780
     gcttctaaaa atcgccaacc tcgcactctt cgatctgacc ttgagtccga ggttcctctt       840
     ctagccgatg ctcactttgc gctccgccgc gtcactgagc cagatgtcca gcgtgagcaa       900
     tgctgtgcgc ccggacgagc cacagatact caccggattg aatcctggtg ggcccagctt       960
     gctaaatcag tagtgacact ataccataac tatttccgcg aacttcacaa ccaaggtctc      1020
     ttctcctcaa cagtaatccc cgaacaagtc gccctcctcg caatctacat gcccactctc      1080
     cgctcccaca ttaaatccta cgtgcaaacc tggaacatgc acaacatccg caaacaagca      1140
     gaccacccag aacgcgcccc tggaaaaccc tatatgaact accaccaccc acccaagggc      1200
     gtagagaact ttggcctccc agccgatgtt cccatgctgc agtccatgca acagaatcat      1260
     gccgactacg atacagagca atatctaccg ccagacaccc tgcactggtg tgagatgcaa      1320
     ctccagcagc tgggcttcga tcctcataaa ccgcctgctc ggctccctgg cgacctacag      1380
     ccgttccgct ccgtttattt ggccctgcgc gagcgggcgt ggcatcatga gcggtctggg      1440
     gctgagccga agttggctgt ttgtgcattt cctggtcagg gcttacgggg ctatttcccc      1500
     tctggacatg cacggtag                                                    1518
//

If you have problems or comments...

PBIL Back to PBIL home page