(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE447

PENCW_10.PE447       Location/Qualifiers
FT   CDS_pept        join(complement(1073680..1073910),
FT                   complement(1073194..1073607),complement(1072354..1073138),
FT                   complement(1071794..1072248),complement(1070587..1071737),
FT                   complement(1066644..1070537),complement(1065749..1066594))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000160879" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15950911"
FT                   /orf_name="Pc13g04470"
FT                   /product="Pc13g04470 protein"
FT                   /function="acyl carrier activity"
FT                   /function="cofactor binding"
FT                   /function="oxidoreductase activity"
FT                   /function="transferase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="biosynthetic process"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP91516.1"
FT                   /db_xref="GO:0000036"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0009058"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0016740"
FT                   /db_xref="GO:0048037"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR001227"
FT                   /db_xref="InterPro:IPR006163"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013217"
FT                   /db_xref="InterPro:IPR013968"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR014043"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016036"
FT                   /db_xref="InterPro:IPR016038"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020801"
FT                   /db_xref="InterPro:IPR020807"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="InterPro:IPR020842"
FT                   /db_xref="UniParc:UPI0001830B88"
FT                   /db_xref="UniProtKB/TrEMBL:B6H299"
FT                   /transl_table=1
FT                   /translation="MRPLSLASGLSGDGAIPPDSLEAIAIVGLATRFPQQATTTESLWE
FT                   LLLQARSTWSSIPKERFNSDAFYHPDPEHGGTFHVQGGHYLSEDPAYFDGSFFNITKNE
FT                   LLTLDPQQRLVLENVYHALENAGIPLTSAVGSNTSVFVSGFNHDYLGILNSDPETTLKY
FT                   KPTGVTNAILSNRVSWFFDFKGPSMTIDTACSSSLVALHLAVQSLRARETNMAVVSGVS
FT                   ILENPTETIGMSHHGLLGPQGRSFSFDSRAEGYARGEGVGTVVVKPLSAAIRDGDTIRA
FT                   VIRETGVNQDGRTPGITVPSADAQERLIREVYWRAGLGLENTRFVEAHGTGTSTGDPIE
FT                   AGALAKAFKCQRETPLYVGAIKSSIGHLEGGSGVASIIKSILTLESGIIPANFDMKQTN
FT                   PSIPAADWNIAFPTEALPWPSPGLRRVSVNSFGIGGTNAHCILDDAYHYLNDRRLTCAH
FT                   RTTSTVPTTQKIKSRLLALFCASPTFTSSTYTSLVEKPKVFLLSAFDEDGVKRNAAEFA
FT                   KYLNRRTSQSVLHDHLLDDLSFTLSKKRSQFPWKSFIMATSVKELAWNLSESNFAKPTR
FT                   AARVPEVEFVFTGQGAQYQAMGRELMVYPAFQESVEEASEYIRRLGSPWSLLDELLTER
FT                   ESPRVNLPEIAHPLCTVLQIALVDLLASWQIFPKRVTGHSSGEIAAAYCSGKLSREGAW
FT                   KVAYYRGYVSSKQLSANGAMMAVGLGASQLQPYLDSVKGKNTGELIIACHNSPKNNTVS
FT                   GDDAMIDRLRSLLDADGIFARKLNVKNAYHSAHMHAIAQDYLRLMGTLPYGRRLAAPHQ
FT                   VHMFSTVTGHQVKEEHLPAQYWVDNMVSPVLFTSGLVAMTSNASSSHGTTDLADSLRLL
FT                   VEIGPHSTLQSAIKETLASKSPKLEFKYLGVLKRTNHSLNTLLTTVGFLASSGCELDFH
FT                   AVNQAPHSKAKRRPRLLVDLPPYIFKHTEKILFESRLSKNIRTRKFPRHDLFGAPITDW
FT                   NPTAPRWRHFVRLNENPWLRDHMVTGNYVYPGVGYLIMAIEASRQLAGEEKITGFRLQK
FT                   VNIRRALIIPDTKEGIEVSLAMATVEDSASSRTWRRFQITSYNASSDEWTDHCTGHITV
FT                   DHETASDPVDNGREAEEESRAWGSEHFRANETCTKSMAFKSTYNNLQTSGLNFGPLFRN
FT                   LADVRASGCGLGKVVGSVTVPDIAQSMPKQYLHSHLIHPATMDSMIHLMIAAVLDFTGK
FT                   STLDQIRLPTFIRDVWVSADLNSAPTHKFTGHASVSTAESDKFEGQIQMLDEGTNRHRI
FT                   RMDGIELTPLESGLAENSERKLCSAIEYKPDVHFLDSKSACALTSLDASDDTQALYWVK
FT                   RLQLATMLYVMDALKELGDLHVTKLDLHMRRFFDWMEHVQTMLKRDEILHLPYNEFLEI
FT                   AQDEALKEAIGKEIEAHSAEGAITARMGRNIAKVVRQETDPLDLMFGQDAVMEQVYKEG
FT                   LHLYNLPQHLQTHLSLIRHQHSELNILEIGGGTGSFTAEVLAVLSPDLAKTKGNIASYT
FT                   FTDISSGFFEKAKQRFQPWSDIMNFQSLNIERSPVDQGFQLGTYDLIFAGNVIHATANL
FT                   HNALSNLRSLLKPGGQLIMQEGIRQDFLWYPLVFGQLPGWWLGDEPCRQWCPYIPAEEW
FT                   NPLLLKAGFSGIDAEYPSSNDPDLTWQSILVSSAVKIPTEKPSNTAIILTLGTLKARQV
FT                   TENLQVLLPELGYTSILVKEPMEVENSILSDALCISLMDLEYPYLFDMTEAEYDTLKKM
FT                   LSECQNLLWVTCNPLTQPHTSMSFGLLRTVRRERDADGSNIVTLTEAEPDVASPQNLAT
FT                   AVGKIIKRQFVDKPENDRHAEYMLQNGLIHIGRLNEWEAADQFLAAQSSQQAPQLQRLG
FT                   DYDTPIELQEAAVSTGEYHWVIDTQQEESHKDTEVEVEIRAIGLSSDVSAGRLANEIAG
FT                   VVSKVGSEVEDLAAGDRVIYISGDKKGGSVRTHGRADQLQLVRIPDEISFEVAAGLAWA
FT                   YATAIQGLGEMARLGPENTILIHTGATDISQAATQYAQMIGATIYATVATVEERDLLVS
FT                   DYGISKERIFSRKDLKFVKSVMRCTNHTGVDVVFNALSGEALRGSMACLAPFGTFVDVS
FT                   NPNKRADTTVEMASLPRNVSVHTVNVPLMAQHRPKSVRLLLTEALRLYSEGKIGQLRTT
FT                   TVLDFTQIKGGIRTAQSGEAAKVVIAPNPSNMVPVVPRPIVPCHFDPDASYVLAGGYGG
FT                   LGRSLARWMASGGATSLIILSRSSASSQEKMELIADLDRMGCKVHSLVCDVADVSSLQR
FT                   LSGEAFSDLPPIKGCIQASMVLRDGAFTGLSFNDWQAAIKPKVQGSWNLHTVLPDDMDF
FT                   FIMLSSVAGIFGNRGQSNYAAGNTFQDALAAYRVSKGMQAASINLGSVSNVGWVAENRS
FT                   SMRTHTATLFELLREEEVHATVDFLIRQDGGNASACSQLVLGLPTAEMCRQNGVPLPTY
FT                   LNYSMFTHFRSTVTAKNSEVSQQKSVSVAALLSAADGFEGAVIVVSDGIVERLASLLAI
FT                   PCSELDAQRFGFGGIDSLVAMEFRAWIVKELKAEVSLLDIMGAENIRALSEKIAGRSRL
FT                   IAGGSSMSS"
     atgcgtcctc tctcactagc aagcggcctt agcggcgatg gagccatacc tcctgattct        60
     cttgaagcca tcgccatcgt tggcctagcc actcgctttc cgcagcaagc aacaaccacc       120
     gagagtctgt gggagcttct cctacaggcc cgctcgacgt ggtcatcgat acccaaagaa       180
     cgcttcaact cggacgcctt ctatcatccg gaccccgagc atggtggaac atttcatgtt       240
     caaggaggac actacctctc agaagaccct gcctacttcg atgggtcctt cttcaatatc       300
     accaagaatg agctcttgac attggacccc caacagcggt tggtactgga aaatgtttat       360
     cacgccttgg aaaatgcagg catcccgttg accagtgctg ttggctccaa cacatcggtc       420
     tttgtcagtg gattcaacca tgactacctg ggtatcctca attcggaccc agaaaccact       480
     ttaaaataca agcccacagg tgtcaccaat gctattctgt ccaaccgtgt cagctggttc       540
     tttgacttca aaggacctag catgactatt gacacggctt gttccagcag cttggtagcg       600
     ctgcatcttg ctgttcagag cttacgtgct agagagacaa acatggctgt cgtcagtggt       660
     gtgagtatcc ttgagaaccc cacagaaacc atcggcatga gccaccatgg tttgttggga       720
     cctcaagggc ggtctttcag ctttgactcc cgtgctgaag gctatgcccg aggcgaaggc       780
     gtgggcacag ttgtagtgaa gcctttgagt gccgctataa gagacggaga taccatccgt       840
     gcggttattc gggagaccgg agtcaaccag gatggccgca cgccaggaat cactgttccc       900
     agtgcagatg cccaagaaag attgatccgt gaggtctact ggagggccgg cttaggtctc       960
     gaaaacacaa gatttgttga agcccatggc acgggaacaa gcaccggtga cccaatcgaa      1020
     gcaggtgctc ttgcgaaagc gttcaaatgt cagcgagaga ctccgcttta cgtcggggcg      1080
     atcaagtctt ccattgggca tctggaaggt ggctcaggtg tggcaagcat tatcaaatct      1140
     attctaaccc ttgagtctgg tatcatacct gcaaactttg atatgaagca gacgaatcct      1200
     tcgattcctg ccgcggactg gaacattgca ttccctaccg aggctcttcc atggccatcg      1260
     ccagggctgc gaagagtgtc agtcaactca tttggaattg gtggcaccaa tgctcactgc      1320
     attcttgatg acgcttacca ctatctcaat gaccgccgtc ttacatgtgc ccatcgcact      1380
     acatctactg ttcccacaac ccagaaaatc aagagccggc tcttggccct cttttgtgca      1440
     tcacccacct tcacgtcgtc aacatacacc agcctggtcg agaaaccgaa agtattcttg      1500
     ctctcagctt tcgatgagga tggcgtcaag cggaacgcag ctgaattcgc caaatacttg      1560
     aaccggagaa cgtcgcagtc ggttctccat gaccatcttc ttgatgatct ctcctttacc      1620
     ctgtcaaaga aacgatccca gtttccctgg aagagtttta ttatggcaac ctcagtcaaa      1680
     gaactcgcat ggaacctgtc agaatcgaat tttgccaagc caaccagggc cgccagagtg      1740
     ccagaggttg aatttgtttt cactggccag ggagctcaat accaggccat gggccgagag      1800
     ctcatggtct accctgcttt ccaggagtcc gtggaggaag catcggaata tatccgccga      1860
     ctcggtagtc cgtggtcatt acttgacgag ctcttgactg agcgagagtc accccgagtc      1920
     aacttgcccg agatcgctca tccattatgc acagtcttgc aaattgcgct cgtcgatctc      1980
     ttggccagtt ggcaaatctt cccaaaacga gtaacgggtc actcatccgg tgagatagct      2040
     gctgcttact gctctggcaa actgtcccgt gaaggcgcgt ggaaggttgc atactaccgt      2100
     ggatacgtat catccaagca gctttctgca aatggggcta tgatggccgt gggtctaggt      2160
     gcatcgcagc tgcagcccta tctggactcc gtgaagggaa aaaacaccgg agaactcatt      2220
     atcgcctgcc acaacagtcc taagaacaac acagtgtctg gagacgacgc tatgattgac      2280
     cgcctcagga gtcttcttga tgccgatggc atctttgctc gaaagttgaa cgtcaagaat      2340
     gcgtatcact cggcccatat gcatgcgatt gctcaggatt atcttcgcct gatgggaaca      2400
     ctcccttatg gaagacggct cgcagctcca caccaggtgc atatgttttc tactgtcaca      2460
     gggcaccaag tcaaagagga acatctgcct gctcagtact gggtggacaa tatggtttct      2520
     cctgttcttt tcacaagcgg tttggttgca atgacctcaa acgcaagctc cagccatggg      2580
     acgaccgatc tagcggattc actgcgcctt cttgtggaga tagggcctca ttcaaccctg      2640
     cagagtgcga tcaaagagac actggcttcg aagagcccta agttggaatt caagtacctg      2700
     ggcgttctta aacggacaaa tcacagcctc aacactctgc tcactacagt cggcttccta      2760
     gcttcgagtg gatgtgaact ggatttccat gctgtgaacc aagcccctca ttctaaggca      2820
     aaaaggcggc ccagactgtt ggtggacctc ccaccgtaca tcttcaagca tactgagaag      2880
     attctgtttg agagtcgact aagcaagaat attcgaactc ggaagttccc tcgtcatgac      2940
     ctctttggtg caccaatcac ggattggaat cctactgctc ccagatggag acattttgtc      3000
     cgattaaacg agaacccctg gctaagggat catatggtca ctggcaacta cgtctaccct      3060
     ggcgtaggct atttgataat ggcaattgaa gcatcgaggc agttagccgg cgaggaaaag      3120
     atcactggct tccgactaca aaaggtcaac atccgaagag ccttgattat acccgatacc      3180
     aaagaaggaa ttgaagtctc cttggcaatg gcaactgtcg aagactcggc atcatcgcga      3240
     acatggcggc ggtttcagat aacttcttac aatgcatcga gcgacgagtg gacagatcac      3300
     tgcactggtc acatcaccgt tgatcatgaa acagcttctg acccagtgga caatggccgc      3360
     gaagcagaag aagaaagccg agcatgggga tccgaacatt tccgcgcaaa tgagacgtgc      3420
     accaaatcca tggccttcaa atccacatac aacaatctcc aaacatccgg ccttaatttt      3480
     ggtcctctgt tccgaaacct cgcagacgtc cgtgcaagtg gatgtgggct tggtaaggtt      3540
     gttggatcag tgacagttcc ggacattgca cagtccatgc caaagcaata tttacattcc      3600
     cacctcatcc atcctgccac aatggatagc atgatccact tgatgattgc ggctgttctt      3660
     gactttaccg gcaagtccac cctggatcag atcagattgc caacttttat acgcgatgtc      3720
     tgggtttcag cggatctgaa ttcagcccca acgcacaaat tcacaggaca tgcaagcgtg      3780
     tcgacggcgg aatctgataa attcgagggc caaatccaaa tgctggatga gggaactaat      3840
     aggcaccgca tccgcatgga cggtatcgag ctcactccac tggagtctgg tcttgctgaa      3900
     aatagtgagc gcaaactgtg cagcgcgatt gaatacaagc ccgacgtcca tttcctcgac      3960
     tcaaaatcag cctgtgcact gacttccctc gatgcttccg atgacaccca ggctctgtac      4020
     tgggtgaaac gtcttcagct tgcaacgatg ctctacgtca tggatgcact gaaggagctc      4080
     ggagaccttc atgtcacgaa actcgatttg catatgcgaa gattctttga ctggatggag      4140
     catgtgcaaa cgatgctcaa gcgcgatgaa atactccacc ttccctacaa tgaattcctg      4200
     gagattgccc aagacgaggc tctcaaggaa gctattggca aggaaatcga ggcccacagc      4260
     gccgaaggcg ccatcacagc ccgaatgggt cgcaacatcg ccaaagttgt gcgacaggag      4320
     actgatccgc tggatctcat gtttggtcaa gacgccgtga tggaacaggt gtacaaagaa      4380
     ggcctccatt tgtataacct gccgcagcat cttcagaccc acttgtctct catccggcac      4440
     cagcattccg agctgaacat ccttgagatc ggtggtggca ctggaagctt cactgctgaa      4500
     gtcctggccg tcctttcgcc agaccttgca aagaccaaag gaaacattgc cagctacaca      4560
     ttcactgaca tttcatccgg cttcttcgag aaagcaaaac agcgtttcca gccatggtcc      4620
     gatatcatga acttccaatc gctcaatatt gagcgaagcc ccgtcgacca gggattccag      4680
     ctggggacat atgacctgat atttgctggc aatgtcattc acgctactgc aaacctgcat      4740
     aacgcattat cgaaccttcg atcgctgttg aagccgggtg gtcagctcat catgcaggaa      4800
     ggaatccgac aggatttcct ctggtatccg cttgttttcg gtcagcttcc cgggtggtgg      4860
     ctgggcgatg agccatgtcg tcagtggtgt ccctacatcc cggccgaaga atggaatcct      4920
     ctgctgctga aagctggatt ctcgggcatt gatgccgagt atcccagttc gaacgatcca      4980
     gatctcacat ggcagagcat tctggtttct tcagccgtca aaatacccac ggagaagccg      5040
     tcgaacactg cgataatctt gacgctcggc acattgaaag cccggcaggt cactgagaac      5100
     ctccaagtac ttttgccgga actgggatac acgagtattc tcgtcaaaga gcctatggaa      5160
     gtggaaaatt ccatcctgtc agatgccctt tgcatctcat taatggattt ggagtacccc      5220
     tacctgttcg atatgaccga agcagaatac gacacgctca agaagatgct cagcgagtgc      5280
     caaaacctac tgtgggtgac ctgcaatccc ctcacacagc cacacacaag tatgagcttc      5340
     ggtcttctcc gaacagtgcg ccgggagcgg gatgccgatg gctcaaatat tgtcaccctg      5400
     acagaggcgg agccagacgt cgcttcacca cagaatctcg ctacagctgt tggcaagatt      5460
     atcaagcggc aattcgtgga caaaccggag aatgatcgcc acgccgagta catgctgcag      5520
     aatggtttga tacacattgg ccgtttgaac gagtgggagg ctgcggatca gttccttgct      5580
     gcacagtcct ctcagcaagc tcctcagctt caacgactcg gtgattatga tactcctatt      5640
     gagttgcagg aggctgctgt tagcaccggg gaatatcatt gggtcatcga tacgcagcaa      5700
     gaagaatcac acaaagacac cgaggtcgag gttgagatcc gggcaattgg tctttcttca      5760
     gatgtctccg ccggccgcct cgcgaatgag attgccggtg ttgtgagcaa ggtcggatcg      5820
     gaagtcgaag acctagccgc cggtgacaga gtcatctaca tctcaggcga caaaaagggc      5880
     ggttctgtcc gaacacacgg tcgagctgat cagctgcagc tcgtgagaat ccccgacgaa      5940
     atctctttcg aagtcgcagc cggtttggct tgggcgtacg cgacagcaat ccaaggactc      6000
     ggggagatgg ctcgtctggg acccgaaaac actatactga ttcataccgg tgcaacggat      6060
     ataagtcaag cggcgactca atatgcccag atgatcggag ctacgatcta cgctactgtg      6120
     gcaacagtcg aagaacgtga tttgcttgtc tctgattatg ggatctctaa agaacgtatc      6180
     ttctccagga aagatctgaa attcgtcaag agtgtcatgc ggtgcacgaa tcatactggt      6240
     gttgacgtcg tcttcaacgc acttagcggc gaggcactcc ggggctcaat ggcatgcctt      6300
     gctccatttg ggacatttgt ggacgtgtcg aatccaaata agcgagctga taccacagtc      6360
     gagatggcct ctttgcctcg caatgtgagt gtccacacag tcaacgttcc tttgatggct      6420
     caacatcgac cgaaatcggt ccgtcttctg ctcactgagg cattgaggtt gtactcagaa      6480
     ggcaagatcg gtcaactccg gacgacaact gtcttggact ttacacagat caaaggaggt      6540
     attcgaactg cgcagagcgg agaagcagca aaagttgtga ttgcacctaa tccgtccaac      6600
     atggtccctg tggtcccacg accaatagta ccatgtcact ttgaccctga cgcctcgtac      6660
     gttcttgctg ggggttacgg tggcttgggc cggagtttag cgcgatggat ggcatctggc      6720
     ggcgcaacaa gcctgattat cctatcgcgc tcatcagctt cgagccaaga gaagatggaa      6780
     ttgattgccg atctcgacag aatgggatgc aaggttcatt cgctggtctg cgatgtggcc      6840
     gatgtctcta gcctccaacg attgtctgga gaggcctttt ccgacctacc tcctatcaaa      6900
     ggatgcatcc aagcatccat ggtcctacgg gacggtgcct tcaccggact ctccttcaac      6960
     gactggcaag cagccatcaa acccaaagtc caaggctcct ggaacctgca cacagtccta      7020
     ccagacgaca tggacttctt catcatgctt tcctccgtcg ccggcatctt cggcaaccgc      7080
     ggacaatcca actacgccgc aggcaacacc ttccaagacg cactagccgc atatcgcgtg      7140
     tcgaaaggga tgcaagcagc cagcataaac ctgggcagtg tatccaacgt cgggtgggta      7200
     gccgagaacc gaagttcgat gcgcacgcac acagcaacat tattcgagct tctgcgcgaa      7260
     gaagaggtcc acgcaacagt cgacttcctc attcgtcaag atggcggtaa tgcatcagcg      7320
     tgttcgcagc tcgttctcgg tcttccgact gcggagatgt gtcgtcagaa cggcgtcccc      7380
     ctgcctacgt atctgaatta ctcaatgttc acgcacttcc gtagtactgt gacggcgaag      7440
     aatagtgagg tttctcagca gaagagtgtt agtgttgcgg cgcttttgtc ggcggcggat      7500
     ggatttgagg gtgctgtgat tgttgtgtcg gatgggattg ttgagagact tgcttctttg      7560
     cttgctattc cctgttcgga acttgatgct cagcgatttg gatttggggg tattgactcg      7620
     cttgttgcta tggagttccg cgcgtggatt gttaaggagc ttaaggctga ggtttctttg      7680
     cttgatatta tgggggcgga gaatattagg gctttgagtg agaagattgc tggcaggagt      7740
     cggttgattg caggaggatc ttctatgtct tcctga                                7776
//

If you have problems or comments...

PBIL Back to PBIL home page