(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE448

PENCW_10.PE448       Location/Qualifiers
FT   CDS_pept        join(complement(1078145..1078314),
FT                   complement(1076939..1078034))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000226718" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15950912"
FT                   /orf_name="Pc13g04480"
FT                   /product="Pc13g04480 protein"
FT                   /function="heat shock protein binding"
FT                   /function="unfolded protein binding"
FT                   /biological_process="protein folding"
FT                   /protein_id="CAP91517.1"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="GO:0031072"
FT                   /db_xref="GO:0051082"
FT                   /db_xref="InterPro:IPR001305"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR003095"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR015609"
FT                   /db_xref="UniParc:UPI0001830B89"
FT                   /db_xref="UniProtKB/TrEMBL:B6H2A0"
FT                   /transl_table=1
FT                   /translation="MQLLRLLVAVAVVLFSVVVIAAEDYYKVLGLAKSASERDIKRAYR
FT                   TLSKKYHPDKNPGDDTAREKFVEIADAYDVLSTSALRKVYDQYGHDGVEQHRKGQAAGG
FT                   SHDPFDLFSRFFGGGGHSGHAPGHRRGPDMEVRAALPLRDFYNGREINFLVEKQQICDS
FT                   CEGTGSKDRQVVTCDRCSGRGMVIQKHMLAPGMFQQVQMQCDKCHGQGKKIKNPCPVCH
FT                   GNRVVKNEVETGATIEPGMGKGTRLVFENEADESPDWVAGDLIVVLDEKEPELGTSEEE
FT                   KTDGTFFRRKGKDLFWKETLSLREAWMGGWTRNLTHLDGHVVRLGRGRGEVVQPLAVET
FT                   IAGEGMPHYSEGHLHDHHDENDEAGNLFVEYTVILPDQMESGMEKDFHALWEKWRKKIG
FT                   VDLAKDSGRPVVSPPAEDKDEL"
     atgcaattat tacgactcct agtcgcggta gccgtggtcc tattctccgt cgttgtaatc        60
     gccgccgagg attactacaa ggttcttgga ctcgcgaagt ccgcgtcaga gagggacatc       120
     aagcgcgcat acagaacact aagcaagaaa tatcaccccg acaagaaccc tggcgatgat       180
     acggcgcgcg agaaattcgt cgaaatagca gacgcctacg atgttctctc gaccagcgcg       240
     ctgcgcaaag tatacgacca atacggacac gacggggtag agcagcaccg caagggccaa       300
     gcggccggcg gcagccacga cccattcgac ctgttctcgc gattcttcgg tggaggcgga       360
     cactcgggcc acgcgcctgg acaccgtcgc ggaccggata tggaggtgcg ggcggcgctg       420
     ccgttgcggg atttctataa tgggcgcgag atcaacttcc tcgttgagaa gcagcagatt       480
     tgtgattcgt gtgaggggac gggctcgaag gatcgacagg ttgtcacttg tgatcgctgc       540
     tctgggcgtg gtatggttat tcagaaacat atgcttgcgc cggggatgtt ccaacaggtg       600
     cagatgcagt gtgataagtg tcatgggcag gggaagaaga ttaagaatcc ttgtcctgtt       660
     tgtcatggga atcgggttgt taagaatgag gttgagaccg gtgctactat tgagcccggg       720
     atgggcaagg ggactaggct tgtgtttgag aatgaggctg atgagagtcc ggactgggtc       780
     gctggagatc tgattgttgt tttggatgag aaggagcctg agcttgggac gtcggaggag       840
     gagaaaacgg atgggacgtt cttccggcgg aaggggaagg atcttttctg gaaggagact       900
     ctttcgctgc gtgaggcgtg gatgggtggt tggactcgca atcttacaca ccttgatgga       960
     catgttgttc gtcttggacg tggacgtggt gaagtcgtgc aacccttggc tgttgagacc      1020
     attgccgggg agggcatgcc gcattactcc gagggtcatt tacatgatca ccatgatgag      1080
     aatgatgagg cgggtaatct gttcgttgag tatactgtta tcctgccgga tcagatggag      1140
     agcgggatgg agaaggactt ccatgccctt tgggagaagt ggcgcaagaa gattggagtt      1200
     gatttagcga aggattctgg gcgaccggtt gtctctccgc cggcggagga taaggatgag      1260
     ttgtga                                                                 1266
//

If you have problems or comments...

PBIL Back to PBIL home page