(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE449

PENCW_10.PE449       Location/Qualifiers
FT   CDS_pept        join(complement(1079550..1079903),
FT                   complement(1079115..1079528))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000048390" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15950913"
FT                   /orf_name="Pc13g04490"
FT                   /product="Pc13g04490 protein"
FT                   /protein_id="CAP91518.1"
FT                   /db_xref="UniParc:UPI0001830B8A"
FT                   /db_xref="UniProtKB/TrEMBL:B6H2A1"
FT                   /transl_table=1
FT                   /translation="MTGFHFSGQQLDNDLVTSISCLLDAADIPNLLWGNYLLTIYGVPT
FT                   VVDVSISLQRSVVGTLLILRQGVSFVVPDTLIEISYSTLSKAGFLPCTQSSDCPYSNTL
FT                   RCPPPVTHLHIDDEKSDVLWEFPDFEIASHNNNSDIWCASDTRLPPASLGRGQGRFPPH
FT                   LYSVQIPSALRYCEALILLLCRDYGSVCETYWMAILTYMLEFVDGTDILDEEGLSEGYR
FT                   PFYRALKQADSRMYLLLEELRRDLIERRILPVK"
     atgacaggtt tccatttcag tgggcaacag ctagataatg accttgtcac ctcgatctct        60
     tgtcttctcg acgcagctga tatcccaaat cttctttggg gcaactatct attaaccatc       120
     tacggagttc ccacggttgt cgacgtcagt atttctcttc aaagatccgt tgttggaaca       180
     ctactaatct tgcgacaggg ggtttccttc gttgtgcccg atactcttat cgaaatctcc       240
     tactctaccc tctctaaagc tggctttctt ccctgcacac aaagctcaga ttgcccgtat       300
     tcgaatacac tacgatgccc cccgcccgtt acacacttac atatcgacga tgagaagtct       360
     gatgtgcttt gggaatttcc agattttgag attgcttccc ataacaacaa ttcggatatt       420
     tggtgtgcgt ctgacactcg gcttcctcca gcaagtctag gccgcggcca agggcgcttc       480
     cccccacacc tctactccgt ccaaatccca agcgccttga ggtactgtga agctcttatc       540
     cttttgcttt gtcgggatta tgggagtgtc tgtgagactt attggatggc aattttgacg       600
     tatatgctgg agttcgttga tggaacggat attcttgacg aagaaggtct gagtgagggg       660
     tatagaccat tttatcgcgc cctaaaacag gcagattcga ggatgtatct acttttggag       720
     gagcttcgcc gtgacttaat agaaaggcgg attctcccag tcaagtaa                    768
//

If you have problems or comments...

PBIL Back to PBIL home page