(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE45

PENCW_10.PE45        Location/Qualifiers
FT   CDS_pept        join(108837..108909,108956..109194,109254..109637)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076569" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128941"
FT                   /orf_name="Pc13g00450"
FT                   /product="Pc13g00450 protein"
FT                   /protein_id="CAP91114.1"
FT                   /db_xref="UniParc:UPI0001830E93"
FT                   /db_xref="UniProtKB/TrEMBL:B6H173"
FT                   /transl_table=1
FT                   /translation="MVLTSNERRAFFRQQCREALAAHIYDRLGLVVAPSDVRLQPSVGD
FT                   KYAWSVTESKKSLLQTNLSSGSVGLYRSICEELGRSLEAVTPQTLQFARLERDHLPKEE
FT                   SGPARSDEEGNGSFTAKIRELECANHEIKNELGRTSIHLQESLGENRTLHAKIRQLQDE
FT                   LDSISSRETQLEDELVRISGGITKAMQVLQEYEAHERGMLYGGRQREYCDSTDSMALGI
FT                   PAPIRDEVF"
     atggtcctca caagcaatga aaggcgcgct ttcttcagac aacagtgtcg tgaggcattg        60
     gcagcccata tatatgatcg acttggtctt gtcgtcgctc ccagcgatgt ccgcctacag       120
     ccatcagtcg gagacaagta cgcttggtcc gtgacggaat ctaagaagag cctgttgcag       180
     acgaacttga gcagtggaag cgtgggcctg tacaggtcca tttgcgagga attgggccgg       240
     tcgcttgagg cagttactcc gcagacgcta cagtttgccc gattggaacg ggaccatctg       300
     ccaaaggaag agtctgggcc agcccgtagt gacgaggagg gaaacggctc tttcacagca       360
     aagatccgcg agttggaatg cgccaatcat gaaataaaga acgagcttgg ccgcaccagc       420
     atccatctcc aggagtccct cggcgagaat cgcacattac acgcaaaaat tcgtcaactt       480
     caggacgagt tggatagtat ttcatctcga gaaactcaac tagaagacga gttggttcgt       540
     atcagtggag ggatcaccaa agctatgcag gtgttgcagg agtacgaagc gcatgagagg       600
     ggcatgctgt atggaggcag gcaacgtgaa tattgtgata gcacagacag catggcgcta       660
     ggaataccgg ctccgatacg cgacgaggtg ttttga                                 696
//

If you have problems or comments...

PBIL Back to PBIL home page