(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE450

PENCW_10.PE450       Location/Qualifiers
FT   CDS_pept        join(complement(1082538..1082931),
FT                   complement(1080637..1082438))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000213851" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15950914"
FT                   /orf_name="Pc13g04500"
FT                   /product="Pc13g04500 protein"
FT                   /function="lipid binding"
FT                   /protein_id="CAP91519.1"
FT                   /db_xref="GO:0008289"
FT                   /db_xref="InterPro:IPR017943"
FT                   /db_xref="UniParc:UPI0001830B8B"
FT                   /db_xref="UniProtKB/TrEMBL:B6H2A2"
FT                   /transl_table=1
FT                   /translation="MPSETEPLLPRYEDDTSRQRRLHQKLHSYQMIRAISEGYMPTTEQ
FT                   TIANLRTLLASDVLNLRNQDIGSVGRQLVRDSRLWIQAFIEFLEQKNGQDQLQQFLWRL
FT                   ARSRVEVDSERVSRQAAHVKARADTKAAYDSFRTVGGLLLTNADFRLFVDDIVTVGRQI
FT                   FADTAESLAESSKRVAEQAKPSEEEEQALQGAGADEGHALSKAEVKEEAAHVADVAGEG
FT                   IAQTSHDAVKSAKEHLSGRERDTLLFRLKQAVQRLRERTDYSDSVSTLTQLIARYARIY
FT                   ADVAENTASVAQEELGVNDDLRRAVDEFWIVLRSFGSAEEWDRLQEKFHNVLRHANKDP
FT                   EFDNLLKEVGTSLHDMLTNPEFFDSAPQKLDELKQHSGRVSSETGLRKDVDDFLAQTKC
FT                   TLRTVPEDPAVSKLINATKKIYQDACGAYNDKKADLPADLVNVFFPVLLRTIQYIPIPR
FT                   LEISAPEMDLLLENLVLEPGHTVNFSSFLPYRMHLLTRNDIDVVKTHSKRTETLMKTAF
FT                   TVTVQGLNISAEDFGYWFRAHTGFFHLKDEGIASFYLDRRGIDISLDIEVGRDRLEHIF
FT                   SLRGVRVCIHKLDYTVKRSKWRFLVWLTKPFLKHLVRRVLEKKIAEEIVAATFALNREL
FT                   VFARERLRATRIANPQDLATFVRAVLARLKPADSDVEARIGIEPQGVFKGIYAPGSIVK
FT                   TWHEEATRAQEAIEEGDETQGLGHTWHNDIFNVAGRY"
     atgccttccg agactgaacc cctcctccct cgctacgagg atgacacctc ccgtcagcga        60
     cgcctccacc aaaagctaca tagctaccag atgatccgcg ccatctctga ggggtacatg       120
     ccaacaaccg aacagaccat cgccaatctg cgcacccttc tagcttctga cgtcctcaac       180
     ctgcgcaatc aggacattgg cagtgtcggt cgccaactag tgcgggacag tcgactgtgg       240
     atccaggcct tcatcgaatt tctggaacag aagaacggcc aagaccagct ccagcaattc       300
     ctgtggcgtc tggcccgttc acgtgtagag gtggatagcg agagggtttc gagacaggca       360
     gcccacgtga aggcgcgggc agatactaaa gctgcatatg acagcttccg caccgtcggt       420
     ggtctgcttc tgactaatgc cgatttccgt cttttcgtcg atgatatcgt taccgttggc       480
     cgccagatct tcgctgatac cgctgagtcc ctcgctgaat cttccaagcg agttgccgaa       540
     caagcaaaac cgtccgagga agaagaacag gctctacagg gggccggtgc cgatgagggg       600
     cacgcgctat cgaaggccga ggtgaaggag gaagctgcac atgttgcgga tgtggccggg       660
     gaagggatcg ctcagacaag tcatgatgct gtaaagagcg ctaaggagca cctgtcaggc       720
     cgagagaggg acaccttgct gttccggttg aaacaggcgg ttcaaaggct ccgggagagg       780
     acggactact ctgattcggt gtcgacactt actcaattga tagcacgcta tgctaggatc       840
     tacgcggatg tagcagagaa tactgcctcg gtcgctcaag aagagctggg agtcaatgat       900
     gacctcaggc gggcggtcga cgaattctgg attgtcttgc ggtcattcgg tagcgcagaa       960
     gagtgggatc ggctgcagga gaagtttcac aatgtcttgc gccatgcaaa caaagatccc      1020
     gagtttgata atctactcaa agaggtcggg acttcgttgc atgacatgct caccaacccc      1080
     gagttcttcg actcggcacc gcagaagctc gatgaactca aacaacactc cggcagagta      1140
     agctcggaga ccggcctacg aaaggatgtg gacgatttcc tcgcccagac caaatgcaca      1200
     cttagaactg tgccggaaga cccagccgtc tccaagttaa tcaatgccac taagaagatc      1260
     taccaggatg cttgtggtgc atacaacgac aagaaggccg accttccagc agacttggtg      1320
     aatgtcttct tcccagtgct cctccgaaca atccaataca tcccaatccc tcgcctggag      1380
     atctctgctc cagaaatgga cctcctcctc gagaacctag tccttgaacc cgggcacaca      1440
     gtaaacttct cctccttcct cccctaccgc atgcatctcc tcactcgcaa tgacatcgac      1500
     gtggtgaaaa cccactccaa gcgcacagaa acactcatga aaacagcctt cacagtcacc      1560
     gtccaaggcc taaacatcag cgccgaagac ttcggctact ggttccgcgc ccacacaggc      1620
     ttcttccacc tgaaggacga aggcatagca agcttctacc tagaccgccg cggtatcgac      1680
     atctcgctag atatcgaagt cggccgcgac cgcctggagc atatcttctc cttgcgcggt      1740
     gttcgcgtat gcatccacaa actcgactac acagtcaagc gcagcaagtg gagattcctc      1800
     gtctggctga ccaagccatt cctgaaacat cttgtgcggc gcgttctaga gaagaagatt      1860
     gcagaggaga ttgttgcagc gacatttgcg ctgaatcgcg agctagtctt tgcccgtgaa      1920
     cggctgcgtg caacacgcat cgctaacccg caggacctgg cgacctttgt gcgggctgtc      1980
     ctcgcgcgcc ttaaacccgc tgactcggat gtcgaggcta ggattggtat tgagccgcag      2040
     ggtgtcttta agggtatcta tgctcccggc agtattgtca agacctggca tgaggaagct      2100
     acacgcgcgc aggaggctat tgaggaggga gatgagacgc aggggcttgg ccatacctgg      2160
     cataatgata tcttcaatgt ggctggacga tactga                                2196
//

If you have problems or comments...

PBIL Back to PBIL home page