(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE451

PENCW_10.PE451       Location/Qualifiers
FT   CDS_pept        join(1085120..1085205,1085284..1085503,1085581..1085659,
FT                   1085778..1086126,1086199..1087273)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000042486" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18978333"
FT                   /orf_name="Pc13g04510"
FT                   /product="Pc13g04510 protein"
FT                   /function="NAD+ or NADH binding"
FT                   /function="malic enzyme activity"
FT                   /function="metal ion binding"
FT                   /function="oxidoreductase activity, acting on the CH-OH
FT                   group of donors, NAD or NADP as acceptor"
FT                   /biological_process="malate metabolic process"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP91520.1"
FT                   /db_xref="GO:0004470"
FT                   /db_xref="GO:0006108"
FT                   /db_xref="GO:0016616"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="GO:0051287"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR001891"
FT                   /db_xref="InterPro:IPR012301"
FT                   /db_xref="InterPro:IPR012302"
FT                   /db_xref="InterPro:IPR015884"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI0001830B8C"
FT                   /db_xref="UniProtKB/TrEMBL:B6H2A3"
FT                   /transl_table=1
FT                   /translation="MARYPLLPTQQNRTVHATPAPFVNHTSPADANYDTANPSYIRKYL
FT                   RTYGLTPPRAEGYETQKARCLAQLGLKSTPIEKFLYLSTLRKNNVHLFYRLVTDHLREL
FT                   TPLIYTPVVGEACQKWSEIYQQPEGMYLSWEDRGNLASVIANWPESNVEITCITDGSRI
FT                   LGLGDLGINGMGIPIGKLALYTACAGIRPEATLPLTLDLGTGNKALREDPLYMGSRRDK
FT                   VSPEEEREFLDELMAALTERWPGIVIQFEDFKNPFPALERYRDMYTCFNDDIQGTGAVI
FT                   LGGVINAVKRSGLPCKDHRAVFFGAGSAGVGVARQIVEFFMREGMTEDEARNCFYLVDT
FT                   KGLVTADRGDKLADHKVYFARRDNNGEQYKTLDEVVDHVKPSILMGLSTMGGVFTPEIL
FT                   RKMADWNTAPLIFPLSNPSSKSECDFETAIANTDGRCLFASGSPFPNCTFTNSAGETRT
FT                   YYPGQGNNMYVFPGIGLGSILSKAVRVTDSMIYASGEALSAALNGEELERGLLYPDITR
FT                   IREVSVVVTRKVMRAAQEDKVDREIALRSLSDVELDNWIKARMYDPHTEVRALEREVGH
FT                   LLSSLGTISPPMTASGSPTEEKNAKL"
     atggctcgat accctttact gcccactcaa caaaaccgga cggtgcatgc caccccggct        60
     ccttttgtga accacacctc gcctgctgat gccaactatg acaccgccaa cccttcatat       120
     atccgcaagt acctgcgcac ctacggcctc actcctcctc gcgccgaggg ttacgagaca       180
     caaaaggccc gctgcctggc acagctgggt ctgaagagca cccctatcga aaagttcctg       240
     taccttagca ctctgcgcaa gaacaatgtt cacctattct accgtctggt gacagaccac       300
     ctcagggaac tgacccccct gatttatacc ccagtggtgg gcgaggcctg ccaaaagtgg       360
     tccgagatct accaacagcc cgaaggtatg tacctgagct gggaagatcg cggaaatctg       420
     gcttcggtca tcgccaattg gcccgagtcc aatgtcgaga tcacatgtat caccgatggc       480
     tcccgaattc tcgggttggg tgatctgggc atcaacggca tgggtatccc cattggcaag       540
     ttggcgcttt acaccgcctg tgcgggtatc cgtcccgagg ccaccctgcc tctgactctc       600
     gatctgggta ctggtaacaa ggccctccgg gaagacccgc tgtacatggg cagccgtcgc       660
     gacaaggtct cacccgagga ggagcgggaa ttcttggacg agctgatggc tgctcttacc       720
     gagcgctggc ctggtatcgt catccaattc gaagatttca agaatccctt ccctgctctt       780
     gagcgatacc gtgacatgta cacctgcttc aacgatgaca tccagggtac tggcgctgtc       840
     atccttggcg gtgtcatcaa cgctgtcaag cgctccggtc tgccctgcaa ggaccaccgt       900
     gccgtgttct tcggcgccgg cagcgccggt gtcggcgttg cccgtcagat tgtcgagttc       960
     ttcatgcgcg aaggcatgac cgaggacgaa gcccgcaact gcttctacct cgtcgacacc      1020
     aagggtctcg tcaccgctga ccgcggcgat aagctcgccg accacaaggt ctacttcgcc      1080
     cgccgtgaca acaacggcga gcagtacaag accctcgacg aggtcgtcga ccacgtcaag      1140
     ccctccatcc tgatgggtct ctccaccatg ggcggcgtct tcaccccaga gatcctgcgc      1200
     aagatggctg actggaacac cgcccctctc atcttccccc tctccaaccc ctcctccaag      1260
     tccgagtgtg acttcgagac cgccatcgcc aacaccgacg gccgctgcct cttcgcctcc      1320
     ggctccccct tccccaactg caccttcacc aactccgctg gcgagacccg cacctactac      1380
     cccggccagg gcaacaacat gtacgtcttc cccggtatcg gcctcggcag catcctgtcc      1440
     aaggccgtcc gcgtcacaga cagcatgatc tacgcctccg gcgaggccct ctccgccgct      1500
     ctcaacggag aggagctcga gcgtggcttg ctctaccccg acatcacccg catccgtgag      1560
     gttagcgtcg tcgttacccg caaggtgatg cgcgctgccc aggaggacaa ggttgaccgc      1620
     gagatcgcgc tccgctctct gagcgacgtc gagctggaca actggatcaa ggcccgcatg      1680
     tatgaccctc acactgaggt ccgcgctctg gagcgtgagg tcggccacct cctctccagt      1740
     ctgggaacaa tctcgccccc catgacggcg agtggctccc cgactgagga gaagaatgcc      1800
     aagttgtaa                                                              1809
//

If you have problems or comments...

PBIL Back to PBIL home page