(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE453

PENCW_10.PE453       Location/Qualifiers
FT   CDS_pept        complement(1090288..1091061)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15950915"
FT                   /orf_name="Pc13g04530"
FT                   /product="Pc13g04530 protein"
FT                   /function="transcription regulator activity"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP91522.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0030528"
FT                   /db_xref="InterPro:IPR001092"
FT                   /db_xref="InterPro:IPR011598"
FT                   /db_xref="UniParc:UPI0001830C47"
FT                   /db_xref="UniProtKB/TrEMBL:B6H2A6"
FT                   /transl_table=1
FT                   /translation="MENDTQTLQMDHTLSHCPWQADKPQPISRDQWPEEGLQWGSDPSF
FT                   CYHGYSSPIGTWTEERLVQNLMRNMASFCTVMDIGFNIPEIIDEPSEKPILDPPELNGF
FT                   TLPMFQPSMVPRNRRLSETPSSPSSSSSSQGQISSPDNTECSRRASCVKPRTQSGQKKR
FT                   KCVQRPGQRLCHCRSEKRRREIIGERYKELCRIVPGLEKQSFTRKYVLEGAALWIQKLV
FT                   QGNDALHQQLEQLKEREKLNQLRLFPVEEDEKLGC"
     atggaaaacg acacccagac acttcaaatg gaccataccc tttcacactg cccctggcaa        60
     gccgacaaac cccaaccaat ctcccgagac caatggccgg aagaaggtct ccaatggggt       120
     tcagatccca gcttctgcta tcacggctat tctagtccca tcggcacctg gacagaagag       180
     agacttgtgc agaatctgat gcggaacatg gccagcttct gcacggtcat ggacattggc       240
     ttcaatatcc ccgaaattat agacgagcca tccgagaagc ctatactgga tccaccagaa       300
     ctgaatggat tcacacttcc catgttccag ccctcgatgg ttccacgaaa tagaagattg       360
     tccgaaaccc catcctcgcc atcttcatcc tcatcgagcc aaggccagat ttcctctccg       420
     gacaatactg aatgttcacg acgggcaagc tgcgtcaaac ccaggaccca gtctgggcag       480
     aagaagagga agtgtgtgca aagaccaggg cagagattgt gccactgtcg atcggaaaag       540
     agaagaagag agatcattgg agagcggtat aaagagctct gccgcattgt accggggctt       600
     gagaaacagt cattcacaag gaaatatgtt ctcgaggggg ctgcactgtg gattcaaaaa       660
     ttggtacagg gcaacgatgc ccttcatcaa caacttgagc agttgaaaga acgagaaaag       720
     ctgaatcagt tacggttatt ccctgttgag gaggatgaaa agttgggctg ctaa             774
//

If you have problems or comments...

PBIL Back to PBIL home page