(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE454

PENCW_10.PE454       Location/Qualifiers
FT   CDS_pept        join(1091863..1093256,1093315..1093556,1093738..1094022,
FT                   1094076..1094276,1094328..1094590)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000217705" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15950916"
FT                   /orf_name="Pc13g04540"
FT                   /product="Pc13g04540 protein"
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP91523.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniParc:UPI0001830C48"
FT                   /db_xref="UniProtKB/TrEMBL:B6H2A7"
FT                   /transl_table=1
FT                   /translation="MPPKGGITKREPPRRRKIALACESCRDKKVRCDGIKPICGPCARR
FT                   SYTVDQCVYKLDNARSASNDEYLKILHNRIRELEETCAKGGVTVPPGPSQDGDYRAPGS
FT                   QSHMGEDMDLDHLDAESRTSVAAEGLLGLGSTPVPSGPIPLSSTPTFQPPRFPAQRNIP
FT                   EAERYRSPHVTHLSPESTQPRAGSIYPSPSLNSHGNVTAMGAISVAEDEPSTDSPREQQ
FT                   YYGNSSVASFMRLAGESMPLQSYMSALRDSKSESSRSQGPDTGIWRDLGHPSVDLRFDD
FT                   FSLPPRSLADHLLECYWDRVHCLFPFFHRPSFEQAYENLWGSDKASKPELPQLNIGLGG
FT                   AFDCGPNSIVFHCALNCIFAIGCYFSDIPPADREAAVYSFFLRAKRFVNLDLLDIGTIG
FT                   VVQTLLIVSLLLQSTPYPNRCWNAIGLACRAGQGLGLHETTTHASNKPLETEIRRRTWH
FT                   SCVIMDMIVSMTHGRPSMTSHISPLPLPAMGTDSEEADPCELSGQPCDHKLGYMTFYVS
FT                   TIELYKILESILSEVYNAWQSRSNTTRTGSFSFCAFRLQFLTKERFIHLRLLLYRPMFT
FT                   QLCSDERAGSSRRSDSQSSERNIIYSTVFSKCAASCVMAAIDLVSLVYKTYRTNVTDAW
FT                   WYNGFYTSTAGFILIMSYSCHSIREQVDSQIVDESWRKCEEILAFMAIFSLSARNSLQF
FT                   LQVTHQHITQNYSATCRPGDPSMVSTQLHQRGNQQPNRPDLSSQPTEPIADEHNLRHGP
FT                   ANMDINLFSTWDEMSLGQEEFGFLGRFDLPDLASWFADIPP"
     atgcctccca aaggtggaat tactaaacgg gagccaccaa ggcgtcgtaa gattgccttg        60
     gcctgcgaat catgccgaga taaaaaggtc aggtgcgatg gtataaagcc aatttgtggc       120
     ccatgtgctc gacgctctta taccgttgac caatgtgtat acaagctgga taatgcgagg       180
     tctgccagca acgatgaata cctgaagatt ctccataatc gtattcggga gcttgaagag       240
     acatgtgcga aaggcggggt tactgttccg cctgggcctt cacaagatgg agattacagg       300
     gcacctggaa gtcaaagtca tatgggtgaa gatatggatc tggatcacct ggatgcagaa       360
     tccaggacat ctgttgctgc tgaaggatta ctaggactgg gttccacccc tgtgccatct       420
     ggaccaattc ctctgtcttc aacgcctact tttcaaccgc caaggtttcc cgcgcagagg       480
     aatataccgg aagctgagcg ctatagatct ccacatgtga cacatctgtc tcctgaatct       540
     acccagccac gagcaggcag tatatatcct tcaccgtctc tcaactccca cggtaacgtc       600
     accgccatgg gtgcaatatc tgttgcagaa gatgaaccaa gcacagactc tccacgggag       660
     cagcaatatt atgggaactc ttcagtggcg tcttttatgc gtctcgcggg agagtcgatg       720
     cctctgcagt cgtacatgtc agctttgcga gacagtaaga gtgagtcgtc aaggtcccag       780
     ggccctgata cggggatttg gcgagattta ggccatccat cggtagatct tcggttcgac       840
     gatttctcct tgccgcctcg atctctggca gaccatcttc ttgagtgtta ctgggacaga       900
     gtacattgtc tattcccatt tttccatcgc cccagctttg agcaagcgta tgaaaatctc       960
     tgggggtcgg acaaggcatc caagcccgag ttgccacagc tcaatattgg actcgggggt      1020
     gcgttcgatt gcggtcctaa ttcaattgtc ttccactgcg cactaaactg catctttgcc      1080
     attggctgct atttctctga tatcccaccc gcggaccggg aggctgcggt ttattctttt      1140
     ttccttcgtg caaagagatt tgtgaatctt gatcttctgg acataggcac tatcggcgtc      1200
     gttcaaacgc ttctgattgt ttcacttctt cttcagagca ccccttatcc gaatcggtgc      1260
     tggaatgcaa ttggactggc atgtcgagct ggtcaaggac tcgggttaca cgagacaacc      1320
     acacacgcct cgaacaaacc cctggagaca gaaatacgac ggcgtacctg gcatagttgt      1380
     gtcattatgg atatgattgt gagcatgaca catggaaggc cgagcatgac ctctcacatc      1440
     tcaccgttgc ctctgcctgc aatgggaacg gactccgaag aagctgatcc ttgtgagctt      1500
     agtggacaac cctgtgacca taagttggga tatatgacat tctatgtttc gaccatcgag      1560
     ttgtacaaaa ttctcgagtc tattctatcc gaggtctata acgcttggca gagtcgatcg      1620
     aacaccactc gcaccggtag cttctctttt tgtgcttttc ggttacaatt tctaactaaa      1680
     gaaagattca tccaccttcg ccttctatta tatcgcccca tgttcactca actctgctcc      1740
     gatgagcgag caggctcgtc acgtcgctct gattcgcaat ccagcgagag aaacattatc      1800
     tactccactg ttttctcaaa atgcgccgcc tcctgcgtca tggcagccat agacctggta      1860
     tcacttgttt acaagacata tcggacaaat gtaactgatg catggtggta caatggattc      1920
     tacacatcga ccgcagggtt catcctaata atgtcgtatt cctgtcattc tatccgggag      1980
     caagttgatt cacaaatcgt ggatgagagt tggcgcaagt gcgaagaaat cttagctttt      2040
     atggctatat tcagtctgtc tgcccgcaac tcgttgcagt ttttgcaggt gacacatcaa      2100
     catattacac aaaactactc agctacttgt cggcctggtg atccctcgat ggtttctact      2160
     cagctacacc aaaggggcaa tcaacaaccg aatcgacccg atttgtcgtc gcagcctacc      2220
     gagcccatag cagacgaaca caacctccgc cacggacccg ctaacatgga tattaatctt      2280
     tttagcactt gggatgagat gagcttgggc caggaagagt ttggattcct tggaaggttt      2340
     gatttgccag atcttgcaag ctggttcgcg gatatacccc cttga                      2385
//

If you have problems or comments...

PBIL Back to PBIL home page