(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE455

PENCW_10.PE455       Location/Qualifiers
FT   CDS_pept        join(complement(1097027..1097146),
FT                   complement(1096880..1096974),complement(1096133..1096829),
FT                   complement(1094806..1096083))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000213840" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20672474"
FT                   /orf_name="Pc13g04550"
FT                   /product="Pc13g04550 protein"
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP91524.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniParc:UPI0001830C49"
FT                   /db_xref="UniProtKB/TrEMBL:B6H2A9"
FT                   /transl_table=1
FT                   /translation="MYELGQSPESSRQTSPASRDHNPRKRGRTACTRCKTRKQKCDNEH
FT                   PACSNCLKAGVSCDKSSVREDKDRQNDYIRGLEERVMFLERKLVESDRSSDQNAAATHT
FT                   ASSLFSPQGGHTTPHTTTSGFDNNPVGEIVGLLALSASEAPAYVGSSSGLSLAADLGEM
FT                   VQTSVWNQFISRMQQKTSTTANNSRNTAGQAQGPTEQSSATQIRDRATRTEDLLPANVE
FT                   PPTDEMGARILETYFTRLHSRYPFLNRNQVWQIHVDRWRLAKIKREDLTRSDRFAIFKL
FT                   NLVYAIGATMLRLSEKYAYTTPERFYTAALQHVPTMCEARSIENIEAMVLLVVYHLRTA
FT                   SSHGMWYMIGLAMRTAIDLGLHRKANESNMDPFTTQMRRRLFWTVYYLERVVSMSLGRP
FT                   FSISDRHIDLDLPLEVDDDIEDPTLLTASLDPNKTTTLTFAIYLFKLRRIDSRIQHKIY
FT                   RADRPLSSLRPKMDPLYLELEQWKESALLRFSGPDLDYPMLHFNRAVRLLIQPFLPLLP
FT                   ITDPYYQICILAAGNICQSHKRLHQTLEYGHSFLAVQTVFMAGITLLYALWTHTDQVWS
FT                   VRMSNDIRACSTVLFVMGERAAWVKKYRDAFELLVNAAMEKLQGNETARNAGMAELMTA
FT                   QYGVNWNSTTAPGMSGSDKFPPVNPTGLAPDTTGATPQGCAGDDSEHAVRMALQLAPWI
FT                   DQDESDPLWVPDFETLENLSGTFWSHGDTRLFDPM"
     atgtatgaac tcgggcagag tcccgagtca tcgaggcaga caagtcccgc atcacgagat        60
     cataacccgc ggaaacgcgg gaggaccgca tgcactcgct gcaagacacg gaagcagaag       120
     tgcgacaatg aacatccggc ttgttccaac tgcttgaagg caggggtctc gtgcgacaag       180
     tccagcgtcc gagaggacaa agaccgacag aatgattaca tacgtggctt agaggagcgt       240
     gtaatgttcc ttgagcgtaa acttgtcgag tctgatcgat catcagacca gaatgctgcc       300
     gctacacata ctgcgtcttc gctgttctcc ccacaaggtg ggcatacaac accgcacaca       360
     actacatcgg gatttgacaa taaccccgtc ggagagattg tgggccttct tgctctcagc       420
     gcctccgagg cccctgcata cgtaggatcc agttctggcc tttctctcgc tgccgacctg       480
     ggggagatgg tccaaacgag tgtatggaac caattcatct caagaatgca gcagaaaacc       540
     agtactaccg ccaataattc tcgaaatacg gcaggccaag cacaggggcc gacggagcag       600
     tccagcgcca ctcaaatccg agatcgagca actaggacgg aagatctcct gccggcgaat       660
     gttgagcctc ccacggatga aatgggggca aggatactcg aaacatattt tacccggctt       720
     cattctcgat atccgtttct taatcggaac caagtatggc agatccatgt ggatcgatgg       780
     cgcctagcga agatcaagcg cgaggatctt actcggtctg atcgatttgc tatcttcaaa       840
     ctcaacctgg tctacgcaat tggcgcaacg atgcttcggc tgagtgagaa atatgcgtac       900
     acgactccag agcgattcta cactgccgcc ttgcagcatg ttcccacaat gtgtgaagca       960
     cgatcaatcg aaaatatcga ggccatggtt cttcttgtcg tgtatcatct ccgaactgca      1020
     tccagtcatg gcatgtggta catgattgga cttgctatgc gtactgctat cgatctaggt      1080
     cttcaccgca aagcaaatga gagcaacatg gatccattta ccactcagat gcgacgcaga      1140
     ctattttgga ctgtatacta tttggagcga gtggtatcaa tgtctcttgg tcgcccgttc      1200
     agtatatccg atcgtcacat tgatcttgac ctcccactcg aagtggacga tgacattgaa      1260
     gatccgacac tactcacagc gtccctagat ccaaacaaaa ccacaacctt gacattcgca      1320
     atttacctct tcaaactccg tcgcatcgac tcccgcatcc aacataaaat ctaccgtgcc      1380
     gaccgtcccc tatcttctct ccgaccaaaa atggaccctc tataccttga actggaacaa      1440
     tggaaagaat ccgccctact gcgattcagc ggcccagatc tcgactatcc aatgctgcac      1500
     tttaatcgag cagtccgcct actaatccag ccattcctcc ccctcctccc aatcacagac      1560
     ccatactacc aaatctgcat cctggcggca ggaaatatat gccaatccca caaacgcctc      1620
     caccaaaccc tggaatacgg ccactccttc ctagccgtgc aaaccgtttt catggctggt      1680
     atcaccctcc tctacgcgct atggacacac acggaccaag tctggtccgt ccgcatgagc      1740
     aacgacatcc gcgcatgctc aacagtcctc ttcgtaatgg gcgagcgcgc agcatgggtc      1800
     aagaaatacc gtgacgcctt cgagttgcta gtcaatgccg ccatggagaa actgcagggg      1860
     aatgagactg cccgcaacgc cggaatggct gagctgatga cggcccagta tggcgttaat      1920
     tggaattcta ctactgctcc tggcatgtca ggtagtgata agtttccccc ggtcaacccg      1980
     accgggctgg ctcctgatac tacgggcgct acgccccagg gttgtgcggg tgatgattct      2040
     gagcatgcgg ttaggatggc gttgcagctg gcgccgtgga ttgatcagga tgagagtgat      2100
     cccctgtggg tgccggactt tgagactttg gagaacttgt ctgggacttt ttggagtcat      2160
     ggtgacacga gacttttcga tcccatgtga                                       2190
//

If you have problems or comments...

PBIL Back to PBIL home page