(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE456

PENCW_10.PE456       Location/Qualifiers
FT   CDS_pept        join(complement(1098650..1099478),
FT                   complement(1098340..1098595),complement(1097612..1098278))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000213829" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15950917"
FT                   /orf_name="Pc13g04560"
FT                   /product="Pc13g04560 protein"
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="CAP91525.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI0001830C4A"
FT                   /db_xref="UniProtKB/TrEMBL:B6H2B0"
FT                   /transl_table=1
FT                   /translation="MNRQREAEKALHDQTNILPFAQLMVVFTGLAISLLICMVDQNGIS
FT                   VTLPTISRELDAQNTISWAGTSSLIANTMFTVLYGRLSDIFGRKIMYISALVLLCIADL
FT                   LCGLSQSPAMFYVFRGLAGVAGGGVTSLTMIIVSDIVTLEKRGKYQGILGASLGIGNII
FT                   GPFLGAAFIMRSTWRGFFWLISPLAACSAVVGYFLIPNNARKDSFRENVGRIDWFGLLA
FT                   SSIGIIFLLIPISGGGSYFPWDSPMVISMLVIGGCSLVAFLLIEWKVATLPMLPVVFFK
FT                   NKVVSAIFLQSFLYGAVYQASLYYLPLYYQNARGWSPIASAAMTCPMVAAQSIFSITSG
FT                   QYISRVKRYGEIIWIGFGLWTLGSGLMLLFGTHTHPAVIAVIVAVMGAGIGFTFQPTLV
FT                   ALQAHCTKSQRAVVIANRNFFRCIGGSCGLAISAAILQATLRSNLPSKFAYLADSSYSL
FT                   PSRANLSATEWASILLSYSKASHAVFILQVPLIGVCFLACMFVRDRGLERPKELEEIEE
FT                   EKRKAQEERDAEAATSDYPEESVDHQAYRQTEKCHSASTFAEPFMPPSRAEPNTEGCGE
FT                   KEQHRGI"
     atgaatcgac aacgagaggc cgaaaaggcc cttcacgacc aaacaaatat tctccccttc        60
     gcgcaactca tggttgtctt cacgggccta gcaatttcct tgctgatttg catggtggat       120
     cagaatggca tcagtgtcac actaccgacg atctcacgcg aactggatgc ccagaatacc       180
     atttcctggg ctggaacctc gtcgctaatt gcaaacacca tgttcaccgt gctttacggc       240
     cgactgtcag atatttttgg ccggaaaatc atgtacattt ccgcgttagt cttgctgtgt       300
     attgcagact tgctctgtgg tttgtcccag agcccagcta tgttttatgt tttccgaggc       360
     ttggctggtg ttgctggtgg tggtgttacc tctttgacga tgattattgt ttccgatatc       420
     gtgaccctgg aaaagcgagg caagtaccag ggtattctag gtgcatctct gggtattggt       480
     aatatcattg gaccatttct gggtgctgca ttcatcatgc gttcaacgtg gcgcggtttc       540
     ttctggttga tttctccatt ggctgcttgt tctgcagtcg ttggatactt cctcattccg       600
     aataatgcac gcaaagatag cttccgagaa aacgttggcc gcattgactg gttcggactg       660
     cttgcatcgt ccattggtat cattttcctc ttgatcccca tctcgggcgg tggatcgtat       720
     ttcccctggg attcaccgat ggtcatcagt atgctcgtta tcggaggttg ttcactcgtt       780
     gcatttttgc ttattgaatg gaaagtggct acacttccga tgctaccagt ggtcttcttc       840
     aaaaataagg tcgtctctgc aatcttcttg cagagctttc tgtatggtgc agtttaccag       900
     gcaagccttt actacctgcc actgtactac cagaatgccc gtggctggtc gccaatagcc       960
     tctgcggcca tgacatgtcc tatggttgcg gcccagtcaa tcttctcaat cacatccgga      1020
     cagtacatct cacgagtaaa gcgctatggt gaaatcattt ggattggatt tggcttgtgg      1080
     accttggggt cgggtctcat gttattattc ggtacccaca cccatcctgc cgttattgcc      1140
     gtcattgtgg cagtcatggg tgccggtatt ggcttcacat tccagcctac cctcgtggct      1200
     ctgcaagctc attgcaccaa gtcccaaaga gcagtcgtga ttgcaaaccg taacttcttc      1260
     cgctgcattg gtggttcatg tggcctcgcc atctctgcag cgattctaca ggctactctt      1320
     cgctctaacc taccaagcaa gttcgcatac ctggcagact cttcatactc gcttccttca      1380
     agagcgaacc tcagtgcaac tgagtgggct tcaatcctgc tctcttacag caaggcttcc      1440
     cacgcagtat tcattctgca ggtccccctc atcggtgtgt gtttcctggc atgtatgttc      1500
     gtgcgtgaca gaggtctgga gcgaccaaag gagctggaag agattgaaga agaaaagcgg      1560
     aaagcccaag aagagagaga tgccgaggcg gctacttctg attaccccga agagtctgtc      1620
     gaccatcagg cataccgcca gacagagaag tgtcattctg catcgacatt cgccgaacca      1680
     tttatgccgc cttctcgggc ggaacctaat actgagggat gtggagagaa ggagcagcat      1740
     cgaggcatat ag                                                          1752
//

If you have problems or comments...

PBIL Back to PBIL home page